[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55955.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  71/915 : Eukaryota  47/199 : Viruses  0/175   --->[See Alignment]
:259 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   65->243 PF09352 * DUF1994 2e-24 46.8 %
:HMM:PFM   60->242 PF09352 * DUF1994 3.1e-55 56.3 158/162  
:HMM:PFM   13->60 PF05145 * AmoA 0.00023 25.0 48/318  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55955.1 GT:GENE BAD55955.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1236944..1237723) GB:FROM 1236944 GB:TO 1237723 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55955.1 LENGTH 259 SQ:AASEQ MKVLSSRRIRRFLGVVGPIVLAALIAAAFAVVEERTGTVSGRTDTAGSAPGSAAEVTGMLAQLKVAPEASMNGYSREKFPHWDSNKAEHGFGAEFTRYSRCTTREVMMLRDAEGAVRLDPATCQLTVGSGGGWRDEYGTLDRKTGQLKPYKWITDPAAVDAEHIVALAEAWRSGAAGMDEQTRRRIANDALNLQASDPTANRSKGDQDAANYLPPGKFRCAYVDRYLRVKVKYGLTVDSAEQAALRTAVDDCVRQGGFR GT:EXON 1|1-259:0| TM:NTM 1 TM:REGION 12->34| SEG 15->32|vvgpivlaaliaaafavv| RP:PFM:NREP 1 RP:PFM:REP 65->243|PF09352|2e-24|46.8|154/160|DUF1994| HM:PFM:NREP 2 HM:PFM:REP 60->242|PF09352|3.1e-55|56.3|158/162|DUF1994| HM:PFM:REP 13->60|PF05145|0.00023|25.0|48/318|AmoA| OP:NHOMO 168 OP:NHOMOORG 118 OP:PATTERN -------------------------------------------------------------------- ----122211112211111-12--1111111-1111234311121--115612331-2--111122325712111211-------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1--------1------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------ ---------------111111111-1-11----11111111111111111111122111111---------------------------1-11-12---------------------------------------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 197-212, 255-259| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHcccccccccccccHHHccccccccccccccccccccccccHHHHHHHHcccccEEEcccccEEEEEccccccccccccccccccEEEEEcccccccEEEEEccccHHHHHHHHHHccHHHHHHHcccccccccccccccHHHccccHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccc //