[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55967.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   54->119 PF04612 * GspM 5.1e-06 24.2 66/160  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55967.1 GT:GENE BAD55967.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1249165..1249578 GB:FROM 1249165 GB:TO 1249578 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55967.1 LENGTH 137 SQ:AASEQ MFIVLGLLVLIAAVVVGVSIAAADLDRMRAPAGDFEIFGSLFTPTVGEVFGVGILVGAAGMLGLLLLSTGVWRSARRGSEARRELRRSRREVAAARRAAPAPQAPAGAPPAPPQTGGPMWSANRFLRRPPGSGPAKA GT:EXON 1|1-137:0| TM:NTM 2 TM:REGION 3->24| TM:REGION 42->64| SEG 3->23|ivlgllvliaavvvgvsiaaa| SEG 51->71|gvgilvgaagmlgllllstgv| SEG 73->113|rsarrgsearrelrrsrrevaaarraapapqapagappapp| HM:PFM:NREP 1 HM:PFM:REP 54->119|PF04612|5.1e-06|24.2|66/160|GspM| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 75-114, 127-137| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHcccccccccc //