[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55986.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:166 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   51->121 PF01680 * SOR_SNZ 0.00013 32.8 67/209  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55986.1 GT:GENE BAD55986.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1267684..1268184 GB:FROM 1267684 GB:TO 1268184 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55986.1 LENGTH 166 SQ:AASEQ MMSEGRKALSRAPQGEPPFRSAGAPVRAGRPAPRRSGARSGAGIQRTLRAVHAAERAAAADGATRFAERAVRMALEVLDRRRPVGQLARLADPTVLAAVRTLVSADLVPGRALGSAVHLRVRLRLLDTDTAEVWAGYDRGGRRFALAARVARTRATGWRLTALRVR GT:EXON 1|1-166:0| SEG 20->43|rsagapvragrpaprrsgarsgag| SEG 49->70|ravhaaeraaaadgatrfaera| SEG 119->126|lrvrlrll| SEG 139->159|rggrrfalaarvartratgwr| HM:PFM:NREP 1 HM:PFM:REP 51->121|PF01680|0.00013|32.8|67/209|SOR_SNZ| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-51| PSIPRED ccccHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccHHHHEEEEccccEEEEEEEEHHHcccccEEEEEEEEc //