[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55994.1
DDBJ      :             putative ABC transporter substrate-binding protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  255/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.8c.94.1
:344 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   69->195 3e4rA PDBj 5e-15 34.4 %
:RPS:PDB   36->327 2de3B PDBj 4e-19 15.2 %
:RPS:SCOP  64->195 1us4A  c.94.1.1 * 2e-13 22.9 %
:RPS:SCOP  187->331 2cbiA2  c.1.8.10 * 3e-07 8.3 %
:HMM:SCOP  33->262 1xs5A_ c.94.1.1 * 3.3e-33 29.5 %
:RPS:PFM   78->259 PF09084 * NMT1 2e-11 33.5 %
:HMM:PFM   47->259 PF09084 * NMT1 1.1e-20 26.7 206/216  
:BLT:SWISS 24->265 SSUA_BACSU 1e-22 29.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55994.1 GT:GENE BAD55994.1 GT:PRODUCT putative ABC transporter substrate-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1275757..1276791 GB:FROM 1275757 GB:TO 1276791 GB:DIRECTION + GB:PRODUCT putative ABC transporter substrate-binding protein GB:PROTEIN_ID BAD55994.1 LENGTH 344 SQ:AASEQ MSRRRAFLRIAFAIAPVVALVAACGSEPDAGSDSGTFVLKVTDPGNSGPLAVGKRDGLFDAALAPLGAKVEWVNTTPGFSSNLKLFNTGELDVSGAAFSPVVGALSKDVGVRIVAVQDPAGKDQSGIIATPQSGIRSVQDLVGKRVAVNPAAKGEYILLRALAQAGVPADQVTRVPLQQKEAASAFATGKVDAWASFLVPYQEAKANGGVEIATEASIGSRDNTVVVFRTEVLDERPDIAAKYLEVLQQLSERQRANPAEFENVFEQTGPRALSGQRLADALRVGGEATVPHLPDQEDAEALADVVDIFLANGVISRAITPADIFYDLRAKLTRDQLAAVRAGS GT:EXON 1|1-344:0| BL:SWS:NREP 1 BL:SWS:REP 24->265|SSUA_BACSU|1e-22|29.3|239/332| TM:NTM 1 TM:REGION 6->25| SEG 3->15|rrraflriafaia| BL:PDB:NREP 1 BL:PDB:REP 69->195|3e4rA|5e-15|34.4|125/291| RP:PDB:NREP 1 RP:PDB:REP 36->327|2de3B|4e-19|15.2|283/347| RP:PFM:NREP 1 RP:PFM:REP 78->259|PF09084|2e-11|33.5|179/200|NMT1| HM:PFM:NREP 1 HM:PFM:REP 47->259|PF09084|1.1e-20|26.7|206/216|NMT1| RP:SCP:NREP 2 RP:SCP:REP 64->195|1us4A|2e-13|22.9|131/298|c.94.1.1| RP:SCP:REP 187->331|2cbiA2|3e-07|8.3|145/317|c.1.8.10| HM:SCP:REP 33->262|1xs5A_|3.3e-33|29.5|217/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 512 OP:NHOMOORG 260 OP:PATTERN ---------------------------------1----------1--1--1----------------- ----1---111---1------1---1------1222144--1--11---11-1-1--1--------11-3--111----------1----------------------------------------------------------1-------1----1-1--1----6-4--------------1------1-11111111111111114-11-111-1-2-----------2------------------------11---------11----1------------------------------------------------------------------------1-----------------1----------1--------34435-113-1-21111111111--66366244-2--3--2--2-2-1-22-----1-2-----11111111----1-----------------------------------1-1-1-126665652222155453333127343331--332-21--23-13--4-----1-----------1------------------1--------1---4-----------------------------------------------------------------1------3211-221111111121-111111111111111111244422-------------------21121112--111111111111-----------------1---------------4443422---6-5535144524411-354---------1----------------1-------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 324 STR:RPRED 94.2 SQ:SECSTR ################EETcHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHTTHHHHHHHTTTEEEEEcEcGGGTTHHHHcccTTEEEEEEEccHHHHHHHHTTcTTcEEEEEEEEEcccEEEEEcTTcccccGGGGTTcEEEEcHHHHHHHHHHHHHHHTTccGGGcEEEEcccTTTcHHHHHTcccEEEEEHHHHHHHHTTTcEcccGGGcGGGcEEEEEEEEHHHHHHcHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHTEEccHHHHHHHHcTTGGGcccccccHHHHHHHHHHHHHHHHTTcccccccHHHHccHHHHHHHTTcEEEE#### DISOP:02AL 1-3, 29-33| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEccccHHHHHHHHccHHHHHHHHcccEEEEEEEcccHHHHHHHHHcccEEEEEEcHHHHHHHHHccccEEEEEEEEEcccccEEEEEEcccccccHHHHcccEEEEcccccHHHHHHHHHHHHcccHHHEEEEEccHHHHHHHHHcccEEEEEEcHHHHHHHHHcccEEEEEEcccccccccEEEEEHHHHHHcHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHccccccccHHHHHHHHHcc //