[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55996.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:SSUB1_NOCFA  RecName: Full=Aliphatic sulfonates import ATP-binding protein ssuB 1;         EC=3.6.3.-;

Homologs  Archaea  55/68 : Bacteria  707/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:245 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   7->202 2r6gB PDBj 8e-13 28.1 %
:RPS:PDB   6->200 3dmdC PDBj 5e-22 7.2 %
:RPS:PDB   171->229 1ak2A PDBj 2e-07 8.6 %
:RPS:SCOP  8->200 1b0uA  c.37.1.12 * 3e-18 23.4 %
:HMM:SCOP  10->201 1ii8.1 c.37.1.12 * 5.1e-59 43.4 %
:HMM:PFM   47->151 PF00005 * ABC_tran 4.1e-22 42.3 104/118  
:HMM:PFM   36->56 PF07728 * AAA_5 9.8e-05 47.6 21/139  
:BLT:SWISS 1->245 SSUB1_NOCFA e-106 100.0 %
:PROS 123->137|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55996.1 GT:GENE BAD55996.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1277638..1278375 GB:FROM 1277638 GB:TO 1278375 GB:DIRECTION + GB:PRODUCT putative ABC transporter ATP-binding protein GB:PROTEIN_ID BAD55996.1 LENGTH 245 SQ:AASEQ MSTEPIAVSITGLRKSFGDKTVLDGVDLTIRRGEFVVLLGPSGTGKTTLLRLLTGLEVPDAGEVLVPGRRTTVYQEPRLIPSKRVLANVLVGLRRTRSNRAAGLAALAEVQLDGKADQWPATLSGGEAQRAALARALVREPELLLLDEPFAALDALTRLRMQDLVGDLVARHRPAVLMVTHDVDEAVRLADRVIVLDRGRFAVDTAITAPRPRERADPDILRYQTEFLAHLGVGGSDRRPIRSAS GT:EXON 1|1-245:0| SW:ID SSUB1_NOCFA SW:DE RecName: Full=Aliphatic sulfonates import ATP-binding protein ssuB 1; EC=3.6.3.-; SW:GN Name=ssuB1; OrderedLocusNames=NFA_11510; SW:KW ATP-binding; Cell membrane; Complete proteome; Hydrolase; Membrane;Nucleotide-binding; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->245|SSUB1_NOCFA|e-106|100.0|245/245| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 123->137|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 43->56|gtgkttllrlltgl| SEG 127->156|eaqraalaralvrepelllldepfaaldal| BL:PDB:NREP 1 BL:PDB:REP 7->202|2r6gB|8e-13|28.1|196/372| RP:PDB:NREP 2 RP:PDB:REP 6->200|3dmdC|5e-22|7.2|195/318| RP:PDB:REP 171->229|1ak2A|2e-07|8.6|58/220| HM:PFM:NREP 2 HM:PFM:REP 47->151|PF00005|4.1e-22|42.3|104/118|ABC_tran| HM:PFM:REP 36->56|PF07728|9.8e-05|47.6|21/139|AAA_5| RP:SCP:NREP 1 RP:SCP:REP 8->200|1b0uA|3e-18|23.4|192/258|c.37.1.12| HM:SCP:REP 10->201|1ii8.1|5.1e-59|43.4|189/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 4648 OP:NHOMOORG 772 OP:PATTERN 441-221-11111-1-5-2121132-13535112111111111351321132111123-11----1-- 1322D11-22212-33322-2611-K22222-A98A9EGD1B5B54511331877224--436-83685643111---11326--1--2233-2-------1----3-----------------12---2------42244---67336766A8778312-2-2778875311----11----3444322-236666568885787877A2445577733232222223339F54443434434444341124411222121112233442111321113331212144333322232321111211212212111222111--225755555644544833222233721A4111CB-4232--711----1--34444-----87USb35AJ76GAEFEEFDEDDET-EENBCKEJLh4-pdcZTQXvpjWXVI211ADTEEIJIB965666666544-434C-----------------------------111242BNJE98IJJJ998998FFNR89996CMCdHGHD-2CD986733D9ECLT16316247333322--21224543A15233225335143115111-33347C191--1---11-----------12-----7591533-3-514334-1333331321331----322------E8HE4B89998998878-9888889888988888889JMKEG2446566666666656566B66578782-8BCCDBCCCDDD--1-11111323313A983335371122232224564524133C6CABCAEACDBD8B6DBD1--------33223555455567611422221211111---311------------1------1---1--------1-------11--122332-42 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---------1--11----1-11--2-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 236-245| PSIPRED ccccccEEEEEEEEEEEccEEEEEcccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEEEEEEcccccccccHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHcccHHcccHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEcccEEEEEEEcccccccccccHHHHHHHHHHHHHHcccccccccccccc //