[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56000.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.74.1
:240 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   52->222 1e4bP PDBj 3e-19 15.7 %
:RPS:SCOP  60->222 1dzuP  c.74.1.1 * 8e-18 15.5 %
:HMM:SCOP  20->230 1jdiA_ c.74.1.1 * 7.4e-23 28.4 %
:RPS:PFM   77->204 PF00596 * Aldolase_II 9e-07 36.0 %
:HMM:PFM   35->204 PF00596 * Aldolase_II 2.5e-12 28.4 162/183  
:BLT:SWISS 77->130 ARAD_BACSU 4e-06 33.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56000.1 GT:GENE BAD56000.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1281657..1282379 GB:FROM 1281657 GB:TO 1282379 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56000.1 LENGTH 240 SQ:AASEQ MTGDLMTTTETRLPAAVADFAAAAARDAERALRVFRETGTVTGNGTVNFVERVPGEEIAVALNAPGPWADDPTVRPIVATFDGTVLDGAGPAGFVTGYAEVFRRHPEITSVVHVHSPWLGGWAQTHRTLPIRYAAAQRLTLSREIPPHIDRSIGAGEFILQRLAEDPDLVAIFEANGGANVIGRSGLLELAKFVVLLEEGAQYQAIAETLGGSVEFDPSNLAVQWGRTGLADEARRRGLI GT:EXON 1|1-240:0| BL:SWS:NREP 1 BL:SWS:REP 77->130|ARAD_BACSU|4e-06|33.3|54/229| SEG 15->31|aavadfaaaaardaera| SEG 38->48|tgtvtgngtvn| RP:PDB:NREP 1 RP:PDB:REP 52->222|1e4bP|3e-19|15.7|166/206| RP:PFM:NREP 1 RP:PFM:REP 77->204|PF00596|9e-07|36.0|125/181|Aldolase_II| HM:PFM:NREP 1 HM:PFM:REP 35->204|PF00596|2.5e-12|28.4|162/183|Aldolase_II| GO:PFM:NREP 1 GO:PFM GO:0046872|"GO:metal ion binding"|PF00596|IPR001303| RP:SCP:NREP 1 RP:SCP:REP 60->222|1dzuP|8e-18|15.5|161/209|c.74.1.1| HM:SCP:REP 20->230|1jdiA_|7.4e-23|28.4|208/223|c.74.1.1|1/1|AraD-like aldolase/epimerase| OP:NHOMO 17 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ------------------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------1--------------------------212-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----11----1------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 166 STR:RPRED 69.2 SQ:SECSTR ###################################################EETTE###EEEccccccGGGccGGGcEEETTccccTTccccTTHHHHHHHHHHcTTccEEEEEccHHHHHHHHHTcccccccGGGGGG#TcccccEEccccTTcHHHHHHHHHHTccccEEEETTTEEEEEEcc#HHHHHHHHHHHHHHHHHHHHHHTTccccccccHHHH################## PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccEEEEEEEEcccccEEEEcccccccccccccEEEEccccccccccccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHcccccccccHHHHHHHHccccEEEcccccccHHHHHHHHHHcccccEEEEcccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHccccEEccHHHHHHHHHHHHHHHHHHHcccc //