[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56002.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  589/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
d.110.3d.58.29f.55.1
:421 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   270->417 3iclA PDBj 1e-14 35.9 %
:RPS:PDB   12->122 1d06A PDBj 4e-07 21.3 %
:RPS:PDB   141->387 3btaA PDBj 2e-57 7.9 %
:RPS:SCOP  4->291 2axtC1  f.55.1.1 * 4e-13 11.9 %
:RPS:SCOP  272->418 1w25A3  d.58.29.2 * 1e-21 26.5 %
:HMM:SCOP  21->124 1ll8A_ d.110.3.5 * 3.9e-12 32.4 %
:HMM:SCOP  121->254 1ew0A_ d.110.3.2 * 2.3e-17 25.2 %
:HMM:SCOP  272->418 1w25A3 d.58.29.2 * 2.2e-42 44.5 %
:RPS:PFM   21->82 PF00989 * PAS 1e-05 44.3 %
:RPS:PFM   269->418 PF00990 * GGDEF 4e-16 43.6 %
:HMM:PFM   267->419 PF00990 * GGDEF 1e-43 41.2 153/161  
:HMM:PFM   143->257 PF08448 * PAS_4 2.8e-12 26.4 106/110  
:HMM:PFM   19->120 PF00989 * PAS 5.7e-10 27.7 101/113  
:BLT:SWISS 147->416 Y091_CAUCR 5e-27 36.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56002.1 GT:GENE BAD56002.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1283550..1284815) GB:FROM 1283550 GB:TO 1284815 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56002.1 LENGTH 421 SQ:AASEQ MNEDTRTPGGTAVAQLAQRYRALVEHSPDAICVHDGDAIAYLNPAGVRLFAADAAEQVLGRPLSQYLIPEGAPPRAEPVRPAQRALATLVRVDGVRVPVQAATVLTVWQGRRAYQVVLHDLSAQRAAEAARQRMERHFAAVVAQLEEGVVVIGRHGRIESINPAALRLFGCEGAELVGASYQALSLCMVDADGAPLAATAHPVARTMRTGEAVTGFVFGIDGHHRGRRWLAGNCRLLDPADRHSAVVASFTDITESRARHRRLRYQATHDDLTGLENRSTILARLERALADPSAEQVAAVLFVDLDRFKSVNDRLGHLAGDEVLRVTARRLRRAVRDRDPIGRLGGDEFLILLRGADVDLGAVLDRLHAVIAEPIRLPGHRVDLAASVGATRLRPGDRRTVTEVLHDADTAMYRAKAAESA GT:EXON 1|1-421:0| BL:SWS:NREP 1 BL:SWS:REP 147->416|Y091_CAUCR|5e-27|36.5|252/809| SEG 123->136|aqraaeaarqrmer| SEG 324->339|lrvtarrlrravrdrd| BL:PDB:NREP 1 BL:PDB:REP 270->417|3iclA|1e-14|35.9|145/159| RP:PDB:NREP 2 RP:PDB:REP 12->122|1d06A|4e-07|21.3|110/130| RP:PDB:REP 141->387|3btaA|2e-57|7.9|202/1277| RP:PFM:NREP 2 RP:PFM:REP 21->82|PF00989|1e-05|44.3|61/112|PAS| RP:PFM:REP 269->418|PF00990|4e-16|43.6|149/160|GGDEF| HM:PFM:NREP 3 HM:PFM:REP 267->419|PF00990|1e-43|41.2|153/161|GGDEF| HM:PFM:REP 143->257|PF08448|2.8e-12|26.4|106/110|PAS_4| HM:PFM:REP 19->120|PF00989|5.7e-10|27.7|101/113|PAS| GO:PFM:NREP 1 GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00989|IPR013767| RP:SCP:NREP 2 RP:SCP:REP 4->291|2axtC1|4e-13|11.9|270/447|f.55.1.1| RP:SCP:REP 272->418|1w25A3|1e-21|26.5|147/162|d.58.29.2| HM:SCP:REP 21->124|1ll8A_|3.9e-12|32.4|102/114|d.110.3.5|1/2|PYP-like sensor domain (PAS domain)| HM:SCP:REP 121->254|1ew0A_|2.3e-17|25.2|127/130|d.110.3.2|2/2|PYP-like sensor domain (PAS domain)| HM:SCP:REP 272->418|1w25A3|2.2e-42|44.5|146/0|d.58.29.2|1/1|Nucleotide cyclase| OP:NHOMO 6273 OP:NHOMOORG 601 OP:PATTERN -------------------------------------------1--31--1-1--------------- B6269---111----6211-1E33-111111-A5557C64BC8Qd-------645-----A83-D4G6653---------9-664B12--------------------1-------------------11--1-1-8996811183SGGCCC112BB---1--58818AD3------------J162-54-341555553451555555--11135554529-CD------8B----------------11----1--------11---1-----------------------------------------------------1852B33333335332A333111616--5344899C73638761-331--82757721111126VON86DSKHMQ3476367777H-QOHNL7JM9R41HNNHQRJSRTEEMB6B939-BB89773--------BEE3-Y9R11111111----11--1111111-1-1-1-87D9397622CACBDC96665DDPY777747HNNBKDJ-2HHGWFWIKT12k96LPPPGSUUK-------44GKZg1BIB8HFK8UJHFH-ICGVCICSJ435366626241----------------F75FB43QKFLYPaHWHXcXYWTTYOXYaRZQMIQeb---AXCY------ABD93G47777777785-5778747777677677668AAA9A--1738877777777778683543245--B23333322333---N-----DEDEF6WBP---------------7676725-1-EQLLKKTTTPSTRQRLMNP-----2---R7GFDKKIJILLKPPFEGLGLJDEG1111--U-993377---------15-------------------------4621444444--- ----1---------------------------------------------------------------------------------------------------------------------------------------------------------2----2---------42-------------7-----3---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 416 STR:RPRED 98.8 SQ:SECSTR ###ETTcTTccEEGGGccccEccccccccHHHHGGGGGccccccccGGGGccccHHHHHHHHHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHHHHHcEEEcccccTTTccccHHHHHHHHHHHHHHHHHHTTccTccccccccTEEEEEcTcccEEEEccccEEEEEccccTTccccHHHHccHHHHHHHccccccccHcEEEEEEETTEEEEEEEEEEEEEEEcccccGGGGGccccccccccccccccccTTTTccHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHcccccccTTccTTcccccGGGEEEEEcTTccEEEEEccEEEEEccccTTccEEEccccccccTccccccEEEEccccEEcEEccccGGGTcTTEEEEEccccccccTHHHHHHHHHHHHHHHTTT## DISOP:02AL 1-3, 8-16, 418-421| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccEEEEcHHHHHHHccccHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEEccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEHHHHHHHHHcccHHHHccccHHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEEEEEcccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHccHHHHHHHHHHHHHHHHHHcccccEEEEEcccEEEEEEcccHHHHHHHHHHHHHHHHcccEEccEEEEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccc //