[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56004.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  158/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:111 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->88 3hh0C PDBj 3e-06 35.3 %
:RPS:PDB   16->108 3d70A PDBj 4e-18 28.0 %
:RPS:SCOP  19->108 1jbgA  a.6.1.3 * 2e-13 30.0 %
:HMM:SCOP  18->105 1jbgA_ a.6.1.3 * 2.3e-18 37.5 %
:RPS:PFM   21->56 PF00376 * MerR 1e-06 55.6 %
:HMM:PFM   21->56 PF00376 * MerR 3e-13 52.8 36/38  
:HMM:PFM   91->110 PF02183 * HALZ 1.7e-05 35.0 20/45  
:HMM:PFM   61->100 PF09278 * MerR-DNA-bind 0.00044 37.5 40/65  
:BLT:SWISS 3->88 HSPR_STRCO 9e-15 46.5 %
:COIL
:REPEAT 2|57->70|73->86

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56004.1 GT:GENE BAD56004.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1285384..1285719 GB:FROM 1285384 GB:TO 1285719 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56004.1 LENGTH 111 SQ:AASEQ MDDDQGRASHLPAPDEAVYGISVAAGLAGIGVQTLRLYERHGLLTPARSDGGTRRYSGDDLARLRRITSLVASGVNLAGVRRILALEDDNAALHEDNQRLRADNESLRSES GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 3->88|HSPR_STRCO|9e-15|46.5|86/151| COIL:NAA 30 COIL:NSEG 1 COIL:REGION 81->110| NREPEAT 1 REPEAT 2|57->70|73->86| BL:PDB:NREP 1 BL:PDB:REP 21->88|3hh0C|3e-06|35.3|68/127| RP:PDB:NREP 1 RP:PDB:REP 16->108|3d70A|4e-18|28.0|93/276| RP:PFM:NREP 1 RP:PFM:REP 21->56|PF00376|1e-06|55.6|36/37|MerR| HM:PFM:NREP 3 HM:PFM:REP 21->56|PF00376|3e-13|52.8|36/38|MerR| HM:PFM:REP 91->110|PF02183|1.7e-05|35.0|20/45|HALZ| HM:PFM:REP 61->100|PF09278|0.00044|37.5|40/65|MerR-DNA-bind| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00376|IPR000551| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00376|IPR000551| RP:SCP:NREP 1 RP:SCP:REP 19->108|1jbgA|2e-13|30.0|90/106|a.6.1.3| HM:SCP:REP 18->105|1jbgA_|2.3e-18|37.5|88/106|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 185 OP:NHOMOORG 158 OP:PATTERN -------------------------------------------------------------------- 1111111111111124311-1-1121111111-1112256133111111111212111111121111121-11111111111111111---------------------------------------------------11111-1-------------------------------------11111----1-------------------------111-----------1-11111111111111-111-------------------------------------------------------------------------------------------------------1---------1--------------------------------------------------------1---111211-1-----------------------------1---------------------------------1----------------------------1----------------------------------------------------------------------1----11111111111111111111111111-------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 85.6 SQ:SECSTR ###############cccEEHHHHHHHHTccHHHHHHHHHTTccccccTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHH# DISOP:02AL 1-17, 108-111| PSIPRED ccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcc //