[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56006.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->84 PF10041 * DUF2277 8e-08 53.8 %
:HMM:PFM   1->84 PF10041 * DUF2277 1.1e-35 65.4 78/78  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56006.1 GT:GENE BAD56006.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1286793..1287062 GB:FROM 1286793 GB:TO 1287062 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56006.1 LENGTH 89 SQ:AASEQ MCRNITALRGLEPAATPEEIQAAALQYVRKVGGLSSISAATRPAVDEAVAEIAAATTRLLERLPERKVPPKTVPPLRRPEVVARLHAHD GT:EXON 1|1-89:0| SEG 44->55|avdeavaeiaaa| RP:PFM:NREP 1 RP:PFM:REP 1->84|PF10041|8e-08|53.8|78/78|DUF2277| HM:PFM:NREP 1 HM:PFM:REP 1->84|PF10041|1.1e-35|65.4|78/78|DUF2277| OP:NHOMO 14 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- --------------1---1-1---1--1111-----2--1-1-1---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 69-75, 84-89| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHccc //