[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56007.1
DDBJ      :             putative competence-damage inducible protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.51.5
:168 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   13->164 2a9sA PDBj 7e-17 17.1 %
:RPS:SCOP  13->164 2a9sA1  c.51.5.1 * 1e-17 17.8 %
:HMM:SCOP  7->164 2a9sA1 c.51.5.1 * 1e-36 38.6 %
:RPS:PFM   18->162 PF02464 * CinA 3e-07 28.3 %
:HMM:PFM   17->161 PF02464 * CinA 1e-41 40.7 145/155  
:BLT:SWISS 8->164 CINA_DESRM 1e-09 25.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56007.1 GT:GENE BAD56007.1 GT:PRODUCT putative competence-damage inducible protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1287107..1287613) GB:FROM 1287107 GB:TO 1287613 GB:DIRECTION - GB:PRODUCT putative competence-damage inducible protein GB:PROTEIN_ID BAD56007.1 LENGTH 168 SQ:AASEQ MDENRRREYRVTDESQRAEELAEVALRQGITIAVAESLTSGKLSAALGAAGDSAEWFRGGIVSYSAQVKHRLLDVPDVPVVSATAAAAMAAGARRLLEADVAVAVTGVGGPDPQDGEPAGSVWFGVVSGDGELTRHHVFDGEPVEVLEQTVDRAVELLLEVVRGDAAR GT:EXON 1|1-168:0| BL:SWS:NREP 1 BL:SWS:REP 8->164|CINA_DESRM|1e-09|25.5|157/411| SEG 37->54|sltsgklsaalgaagdsa| SEG 83->93|ataaaamaaga| SEG 99->110|advavavtgvgg| RP:PDB:NREP 1 RP:PDB:REP 13->164|2a9sA|7e-17|17.1|152/167| RP:PFM:NREP 1 RP:PFM:REP 18->162|PF02464|3e-07|28.3|145/155|CinA| HM:PFM:NREP 1 HM:PFM:REP 17->161|PF02464|1e-41|40.7|145/155|CinA| RP:SCP:NREP 1 RP:SCP:REP 13->164|2a9sA1|1e-17|17.8|152/167|c.51.5.1| HM:SCP:REP 7->164|2a9sA1|1e-36|38.6|158/0|c.51.5.1|1/1|CinA-like| OP:NHOMO 8 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------1----------------------------1112----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 90.5 SQ:SECSTR ############HHHHHHHHHHHHHHHHTccEEEEEcTTTTHHHHHHTTcTTGGGTEEEEEEcccHHHHHHHHcccHHccccHHHHHHHHHHHHHTccccEEEEEEEcccccccccccTTEEEEEEEETTccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHT#### DISOP:02AL 1-3, 165-168| PSIPRED cccccccccccccHHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHcccccHHHHcccEEEEcHHHHHHHccccccccccHHHHHHHHHHHHHHHcccEEEEEEEEEccccccccccEEEEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHcc //