[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56008.1
DDBJ      :             putative cold shock protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  193/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:89 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->70 1g6pA PDBj 2e-11 55.8 %
:RPS:PDB   17->79 1c9oA PDBj 4e-14 45.9 %
:RPS:SCOP  17->79 1c9oA  b.40.4.5 * 4e-14 45.9 %
:HMM:SCOP  7->82 1h95A_ b.40.4.5 * 1.3e-14 40.0 %
:RPS:PFM   17->64 PF00313 * CSD 5e-09 57.4 %
:HMM:PFM   16->76 PF00313 * CSD 3.1e-19 50.0 60/67  
:BLT:SWISS 17->80 CSPB_YERPE 6e-12 52.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56008.1 GT:GENE BAD56008.1 GT:PRODUCT putative cold shock protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1287739..1288008 GB:FROM 1287739 GB:TO 1288008 GB:DIRECTION + GB:PRODUCT putative cold shock protein GB:PROTEIN_ID BAD56008.1 LENGTH 89 SQ:AASEQ MTCAMPAPPEASTWYHGTVAWFDAPKGFGFIEPAEGPRGPVFVDFSSIEMSGYRTLVEGQPVRFVRSAGRAEAVAVRPLAETGSAGVAA GT:EXON 1|1-89:0| BL:SWS:NREP 1 BL:SWS:REP 17->80|CSPB_YERPE|6e-12|52.4|63/70| BL:PDB:NREP 1 BL:PDB:REP 17->70|1g6pA|2e-11|55.8|52/66| RP:PDB:NREP 1 RP:PDB:REP 17->79|1c9oA|4e-14|45.9|61/66| RP:PFM:NREP 1 RP:PFM:REP 17->64|PF00313|5e-09|57.4|47/67|CSD| HM:PFM:NREP 1 HM:PFM:REP 16->76|PF00313|3.1e-19|50.0|60/67|CSD| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00313|IPR002059| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00313|IPR002059| RP:SCP:NREP 1 RP:SCP:REP 17->79|1c9oA|4e-14|45.9|61/66|b.40.4.5| HM:SCP:REP 7->82|1h95A_|1.3e-14|40.0|75/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 356 OP:NHOMOORG 194 OP:PATTERN -------------------------------------------------------------------- ----2----------------1--------------3---1-----1----------2--32--211-11--------------------------------------------------------------------------------------------------------------------11----------------------------------------------1111111111111--11------11---------11----------------------------------------------------------------------------------------1-----------1-----------------------1-----------------------1--------------------------------------------------------------------------------------------------------------1-1-----------------------------------1---------------------------------1----------------------------211--311-1911111111111--111111------11-122223333323223322-32-2232222332233223224222123322222222222222222422222222-753565535466--11----------11-1--------------------1---21-11111121-1111-------------111111111111111-------------------------------------------------------------2---111-1--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 89.9 SQ:SECSTR #########HTTccEEEEEEEEETTTTEEEEEETTETTEEEEEEGGGccccccccccTTcEEEEEEETTEEEEEEEEEcTcTTcccccc DISOP:02AL 1-13, 82-89| PSIPRED cccccccccccccccccEEEEEEccccEEEEEEccccccEEEEEEEEEccccccccccccEEEEEEEEcccccEEEEEEcccccccccc //