[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56013.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:170 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   48->125 PF04138 * GtrA 7e-05 34.2 %
:HMM:PFM   48->163 PF04138 * GtrA 2.4e-24 31.6 114/117  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56013.1 GT:GENE BAD56013.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1295618..1296130 GB:FROM 1295618 GB:TO 1296130 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56013.1 LENGTH 170 SQ:AASEQ MTADAVRAPDAPATWPPPRSATATAETRDAGVDPGPLLRVVRRQELAFAVVGAFNTALGMALTVLWLLVLGAGVSPAVAPALAYAVSIVVAFTLHRTLVFRVRGRLVRDFVAFVVVNSGGLLMNMALLQLAVQVAHLPRIPAALGVMAVVAVASFFGHRHISFRRRPPLR GT:EXON 1|1-170:0| TM:NTM 4 TM:REGION 47->69| TM:REGION 77->99| TM:REGION 109->131| TM:REGION 138->159| SEG 126->135|allqlavqva| SEG 142->153|aalgvmavvava| RP:PFM:NREP 1 RP:PFM:REP 48->125|PF04138|7e-05|34.2|76/116|GtrA| HM:PFM:NREP 1 HM:PFM:REP 48->163|PF04138|2.4e-24|31.6|114/117|GtrA| GO:PFM:NREP 3 GO:PFM GO:0000271|"GO:polysaccharide biosynthetic process"|PF04138|IPR007267| GO:PFM GO:0006810|"GO:transport"|PF04138|IPR007267| GO:PFM GO:0016021|"GO:integral to membrane"|PF04138|IPR007267| OP:NHOMO 7 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------1-----------22-----------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 6-7, 169-170| PSIPRED ccccccccccccccccccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccc //