[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56014.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.160.1
:182 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  81->180 1zatA1  b.160.1.1 * 2e-16 27.3 %
:HMM:SCOP  71->181 1zatA1 b.160.1.1 * 3e-22 30.9 %
:HMM:PFM   82->180 PF03734 * YkuD 1.2e-19 32.0 97/116  
:HMM:PFM   39->76 PF06003 * SMN 7.8e-05 31.6 38/264  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56014.1 GT:GENE BAD56014.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1296220..1296768 GB:FROM 1296220 GB:TO 1296768 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56014.1 LENGTH 182 SQ:AASEQ MQRSPPGREGRCVMSRLRKRHWAGRLAVVLGLASAAGFGTGIAQAEPLWPGGPDIPGVPAIIQPPPPVAPCSAQARACMRLSTNEAWLMDNGRVTYGPTPVSHGMPGYETPPGVFKVSFKREFHWSTMHNAPMPYATFFNGDIAFHVGPIEKESHGCVRMTHEGAKAFYEYLWPGDVVEVVE GT:EXON 1|1-182:0| SEG 23->37|agrlavvlglasaag| SEG 55->70|ipgvpaiiqppppvap| HM:PFM:NREP 2 HM:PFM:REP 82->180|PF03734|1.2e-19|32.0|97/116|YkuD| HM:PFM:REP 39->76|PF06003|7.8e-05|31.6|38/264|SMN| RP:SCP:NREP 1 RP:SCP:REP 81->180|1zatA1|2e-16|27.3|99/126|b.160.1.1| HM:SCP:REP 71->181|1zatA1|3e-22|30.9|110/0|b.160.1.1|1/1|L,D-transpeptidase catalytic domain-like| OP:NHOMO 27 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- -----112111111----------------------1---------------------------1-2111-----------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------11-1-11------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED ccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEcccccccccccccEEEEEccccEEEEEEccEEEEEEEEEEccccccccccEEEEEEEEEEccccccccccccEEEEEEccEEEEccccccccccEEcccHHHHHHHHHHcccccEEEEEc //