[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56023.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:363 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->94 2ep5D PDBj 3e-04 32.4 %
:RPS:PDB   8->317 3btvA PDBj 7e-09 9.3 %
:RPS:SCOP  9->151 1ebfA1  c.2.1.3 * 8e-09 13.7 %
:HMM:SCOP  15->146 1mb4A1 c.2.1.3 * 1.9e-07 20.2 %
:RPS:PFM   15->80 PF01113 * DapB_N 1e-11 43.9 %
:HMM:PFM   15->78 PF01113 * DapB_N 1.3e-09 42.9 63/124  
:BLT:SWISS 15->71 DAPB_SYNY3 4e-08 36.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56023.1 GT:GENE BAD56023.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1306792..1307883) GB:FROM 1306792 GB:TO 1307883 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56023.1 LENGTH 363 SQ:AASEQ MTEPTRPPIRVFQVATGNVGTEMIKRIGNHPDLELIGVHCYTPEKIGRDVGELAGLAPIGVVATGSVDEILAARPDVLTFHGVFPDEDLYVRVLEAGIDVVTTADWITGHHRDANHPHPSGRRTSEVIAEACRKGGSTFYGTGMNPGLCQILGIVHTCDVADIENVTVIESVDVSCHHSAETWRAVGYGLPVDDPSIPGSLEKYTSVFADSVHLMADCFDLTLDEVTFDYELGACTKDVDLGWYHLPEGSLGGSYIRYRGMVDGVARVESHLEWQMTPHTDPKWEIKGCYITRITGDPNVYSKHMIFPRAGVDLTDPSSFASIGMTVTGLPALNAIRSVVAAPPGILTSADLPLRAFAGRFAR GT:EXON 1|1-363:0| BL:SWS:NREP 1 BL:SWS:REP 15->71|DAPB_SYNY3|4e-08|36.8|57/275| BL:PDB:NREP 1 BL:PDB:REP 15->94|2ep5D|3e-04|32.4|74/348| RP:PDB:NREP 1 RP:PDB:REP 8->317|3btvA|7e-09|9.3|300/390| RP:PFM:NREP 1 RP:PFM:REP 15->80|PF01113|1e-11|43.9|66/123|DapB_N| HM:PFM:NREP 1 HM:PFM:REP 15->78|PF01113|1.3e-09|42.9|63/124|DapB_N| GO:PFM:NREP 3 GO:PFM GO:0008839|"GO:dihydrodipicolinate reductase activity"|PF01113|IPR000846| GO:PFM GO:0009089|"GO:lysine biosynthetic process via diaminopimelate"|PF01113|IPR000846| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01113|IPR000846| RP:SCP:NREP 1 RP:SCP:REP 9->151|1ebfA1|8e-09|13.7|131/168|c.2.1.3| HM:SCP:REP 15->146|1mb4A1|1.9e-07|20.2|129/148|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 148 OP:NHOMOORG 39 OP:PATTERN -----------------1-------------------------------------------------- --------------3BB22-2F--86222223CBCB3221-2-5------------------11-----1--------------------------------------1----------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------1------1--111--------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 313 STR:RPRED 86.2 SQ:SECSTR ####ccccEEEEEEcccTTcccTTTTHHTTTTEEEEEEEcccHHHHHHHHHHHHHHTTcTTcEEEccHHHHHHcccccEEEEcccHHHHHHHHHHHGGGcEEccTTTTccEEEEEccccccHHHHHHHHHHHHTTTcEEEEEcGGGGcHHHHHHHHHHHTTTTccEEEEEEEEEccccccEEETTccGGGGcTTccccTTTTHHHHHHHHHHHHHTccEEEEEEEEEccccEEEEEcTTccEEEEEEEcccccEEEEEEEETTTTEEEEEEEEccccccccEEEEEEEcccEEEEEccccEEEEEEEcccEEEEEEc############################################## DISOP:02AL 1-4| PSIPRED ccccccccEEEEEEcccHHHHHHHHHHHcccccEEEEEEEcccccccccHHHHcccccccEEEEccHHHHHcccccEEEEccccccHHHHHHHHHccccEEccccHHccccccccccccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEEEcccccccHHHHHcccccHHHHccHHccccccccHHHHHHHHHHHcccEEEEEEEEEEEEEcccEEEcccEEccccEEEEEEEEEEEEEccEEEEEEEEEEcccHHccccccccccEEEEEEccccccEEEccccccccEEEcccccccccHHHHHHHHHHHHHHHHHcccccEEHHHcccccccccccc //