[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56024.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  161/915 : Eukaryota  31/199 : Viruses  0/175   --->[See Alignment]
b.33.1d.129.3
:331 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->325 2zylA PDBj 2e-29 28.5 %
:RPS:PDB   12->325 2ckfE PDBj 1e-23 14.4 %
:RPS:SCOP  12->110 1eg9A1  b.33.1.2 * 2e-18 20.2 %
:HMM:SCOP  12->119 1eg9A1 b.33.1.2 * 1.9e-26 29.6 %
:HMM:SCOP  101->327 1z01A2 d.129.3.3 * 5.1e-12 23.5 %
:RPS:PFM   34->82 PF00355 * Rieske 6e-04 36.7 %
:HMM:PFM   13->105 PF00355 * Rieske 3.1e-17 27.9 86/97  
:HMM:PFM   189->271 PF03466 * LysR_substrate 8.2e-05 12.5 80/209  
:BLT:SWISS 4->117 CAO_ORYSJ 5e-11 31.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56024.1 GT:GENE BAD56024.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1307928..1308923) GB:FROM 1307928 GB:TO 1308923 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56024.1 LENGTH 331 SQ:AASEQ MAKPPLPMNPTGWFQVAWSAEVGVGEVRRMSYFGREMICWRSASGAVAVMDAYCEHLGAHLGHGGTVDGERIVCPFHGWEWNREGRNVCIPYEDRPNPVRRIRSYPVVERNESIYLWHDVHGRAPYFEVPDVFTGFGDGRTEADYHRAHPHGTLFRERLELHPQYVLENGVDFAHFTYVHKVPIVPVFTRQEFDGPISRVDFTIDFGAGARSADDVRSGVQAINAGLGVAVTKSWGMVDNRTVSAVTPVDDATCDVRFTVWIGCPPGKDRDNPSDKALMFGQAVIDQFLADIHIWSHQRYSDPPALARAEYAGFKALRTWARQFYPADRVR GT:EXON 1|1-331:0| BL:SWS:NREP 1 BL:SWS:REP 4->117|CAO_ORYSJ|5e-11|31.5|111/541| BL:PDB:NREP 1 BL:PDB:REP 12->325|2zylA|2e-29|28.5|295/359| RP:PDB:NREP 1 RP:PDB:REP 12->325|2ckfE|1e-23|14.4|313/433| RP:PFM:NREP 1 RP:PFM:REP 34->82|PF00355|6e-04|36.7|49/95|Rieske| HM:PFM:NREP 2 HM:PFM:REP 13->105|PF00355|3.1e-17|27.9|86/97|Rieske| HM:PFM:REP 189->271|PF03466|8.2e-05|12.5|80/209|LysR_substrate| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00355|IPR017941| GO:PFM GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|PF00355|IPR017941| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00355|IPR017941| RP:SCP:NREP 1 RP:SCP:REP 12->110|1eg9A1|2e-18|20.2|99/154|b.33.1.2| HM:SCP:REP 12->119|1eg9A1|1.9e-26|29.6|108/154|b.33.1.2|1/1|ISP domain| HM:SCP:REP 101->327|1z01A2|5.1e-12|23.5|200/0|d.129.3.3|1/1|Bet v1-like| OP:NHOMO 400 OP:NHOMOORG 192 OP:PATTERN -------------------------------------------------------------------- --1-2--1111---48411-15--351-111355655454-13-----------------112--11-21-----------------------------------------------------------------1------------2212---11----1--3-12132--------------------1--------------1----------------------------------------------------------------------------------------------------------------------1--------------------------------------------------3--1-------322---2--2-------------1----12--------1-----111------1-----1--22222222-3331----------------------------------5P--1----4443552111144211222-14252522--11-1----313132-3--------------------1---------------------------11-------------------------------------11--------1------1--------1---------------------------------------------1-----------------------1----------------------------------1--1----------------332231------1111-1------1-------1-11-------------------11111-----------------------------------------------------1--1-2-2111-- --------------1--------------------------------------------------------------------------------------------2-2411121---------------------------------------1--223223121111-111-----6---11-23----------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 324 STR:RPRED 97.9 SQ:SECSTR #ccccccccccccEEEEEGGGccTTEEEEEEETTEEEEEEEcTTccEEEEEcccTTTccccccccEEEcccEEcTTTccEEcTTccEEEcTTTTTTTTTccccEEEEEEETTEEEEEccTTcccHHHHHGGGGHHHHHHHHTTTcccEEEEEEEEEEEEcccTHHHHHHHHccTTHHHHTHHHHTccEEEEcTTccEETTcGGGGcccccHHHHHHHHHHHHHHHHHcHHHHHHHTcEEEcEEEEEEEccTTcEEEEEEEEEETTccHHHHHHHHHHHHHHHcTTcTTGGGHHHHHHHHHGHccEEEccTTTTcEEcccccccEE###### DISOP:02AL 1-2, 329-331| PSIPRED cccccccccccccEEEEEHHHcccccEEEEEEccEEEEEEEccccEEEEEEccccccccEEccccEEcccEEEEcccccEEcccccEEEccccccccccccccEEEEEEEccEEEEEccccccccHHHcccHHHHHHHHHHHccccccEEEEEEEEEEEcccHHHHHHHcccHHHHHHccccccccccccEEccccEEEEEEEEEEcccccccccccccEEEEEEcccEEEEEEccccccEEEEEEEEEccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHccc //