[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56029.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  242/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->160 2ot9A PDBj 1e-19 35.7 %
:RPS:PDB   2->176 3c0uB PDBj 2e-34 30.6 %
:RPS:SCOP  5->166 2g3wA1  c.52.1.33 * 1e-42 27.3 %
:RPS:PFM   1->171 PF07152 * YaeQ 6e-31 38.8 %
:HMM:PFM   1->174 PF07152 * YaeQ 1.8e-59 38.7 173/175  
:BLT:SWISS 1->175 YAEQ_SHIFL 4e-19 30.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56029.1 GT:GENE BAD56029.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1312909..1313451 GB:FROM 1312909 GB:TO 1313451 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56029.1 LENGTH 180 SQ:AASEQ MALNATMHSFAIQLADVDRGVYTDMEVRVARHPSETAEFMLTRLLAYCLEYTEGIAFSDGGVSATDEPAVAVRDATGRLLCWIEIGAPDAERVHRGSKAAERVAIYTHRDPAKVLAQLRGKRIHRAEQIPLYALDRAFIDAAVAAIERRNTLTLSVTERRLYLDVNGSGFETAVTEHRFG GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 1->175|YAEQ_SHIFL|4e-19|30.5|174/181| BL:PDB:NREP 1 BL:PDB:REP 5->160|2ot9A|1e-19|35.7|154/176| RP:PDB:NREP 1 RP:PDB:REP 2->176|3c0uB|2e-34|30.6|170/177| RP:PFM:NREP 1 RP:PFM:REP 1->171|PF07152|6e-31|38.8|170/176|YaeQ| HM:PFM:NREP 1 HM:PFM:REP 1->174|PF07152|1.8e-59|38.7|173/175|YaeQ| RP:SCP:NREP 1 RP:SCP:REP 5->166|2g3wA1|1e-42|27.3|161/179|c.52.1.33| OP:NHOMO 244 OP:NHOMOORG 243 OP:PATTERN -------------------------------------------------------------------- --------------1------1---1------11111-----------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------111-111111111121111111111111111111111111111111111111111111----------1111-1-1----------1111111111111-1-----------------------------111111111111111111111111111111------1------11111111111111111-111111111111111111111111---1111111111111111111111111-111111111111--------------11-1---------------11111-1---1111111111111111111----------1111-----11111111111111---------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 97.8 SQ:SECSTR cccccEEEEEEEEEEETTTTEEEEEEEEEEEcTTccHHHHHHHHHHHHHTccTTcEEccccGcccccccEEEEcTTccEEEEEEEccccHHHHHHHHHHEEEEEEEEccHHHHHHHHTTHHHHTTcTTEEEEEccHHHHTHHHHTTcccEEEEEEEETTEEEEEccccEEEEEcEE#### DISOP:02AL 1-2| PSIPRED cccccEEEEEEEEEEEcccccccccEEEEEEcccccHHHHHHHHHHHHHcccccEEEEEccccccccHHHEEEcccccEEEEEEEccccHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHcccccccEEEEccHHHHHHHHHHHccccEEEEEEEccEEEEEccccEEEEEEEEEEcc //