[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56037.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:206 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   108->191 PF02517 * Abi 1.3e-09 28.6 84/99  
:BLT:SWISS 144->199 NU2M_STRCA 3e-04 39.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56037.1 GT:GENE BAD56037.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1319650..1320270) GB:FROM 1319650 GB:TO 1320270 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56037.1 LENGTH 206 SQ:AASEQ MNRRDRAPVVLVGALGTGLLGVSLSAPPDSARFYGLTLATAATFTAGGLAATPPGPPGDRRVLPPVLLGVGAFGVFYGCALVARRIPLLRRAIAHLLRYADRGRTPAVLLTALANGAAEEVFFRGAVYAAAGTHPVAVSTGVYVLTTTATRNPALVLAAAVMGSLFGLQRRRTGGITASLLTHLTWSTLMLHYLPPLFLPEPGRNS GT:EXON 1|1-206:0| BL:SWS:NREP 1 BL:SWS:REP 144->199|NU2M_STRCA|3e-04|39.3|56/100| SEG 9->22|vvlvgalgtgllgv| SEG 35->58|gltlataatftagglaatppgppg| SEG 80->100|alvarripllrraiahllrya| HM:PFM:NREP 1 HM:PFM:REP 108->191|PF02517|1.3e-09|28.6|84/99|Abi| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ---------------1111-11--111111111-111-------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 202-206| PSIPRED cccccEEHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccc //