[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56038.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  201/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:298 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->73 2iodD PDBj 2e-06 38.0 %
:RPS:PDB   3->288 3c1oA PDBj 4e-13 11.3 %
:RPS:SCOP  3->203 1xq6A  c.2.1.2 * 1e-22 23.3 %
:HMM:SCOP  1->288 1qydA_ c.2.1.2 * 2.5e-47 29.6 %
:RPS:PFM   3->230 PF05368 * NmrA 2e-08 29.1 %
:HMM:PFM   3->142 PF05368 * NmrA 1.5e-13 33.1 133/233  
:BLT:SWISS 3->290 YBJT_ECOLI 1e-39 32.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56038.1 GT:GENE BAD56038.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1320267..1321163) GB:FROM 1320267 GB:TO 1321163 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56038.1 LENGTH 298 SQ:AASEQ MDVLVAGATGFIGQRLCPKLVTAGHRVRAMTRAPMSYRGVGTPVGADVADPASLRAALDGCDSAYYLVHSLTKTDFRARDATAARNFGTAAAAAGVHRIIYLGGLGDDNDDLSEHLRSRREVESLLADGGVPVTTLRAGIIVGHGGISWEITRQLVEHLPVMVAPRWVRTRTQPIAADDVIRYLVGVLEIPGTAGRTFDIGGPDVLAYLDMLRRVARIEGRPALILPVPLLSPRLSAQWLALVTDVDVRTGRSLVDSMVNEVLVRDTAIREFLPFEPMGYDAAVLRALGERVGLRDGT GT:EXON 1|1-298:0| BL:SWS:NREP 1 BL:SWS:REP 3->290|YBJT_ECOLI|1e-39|32.4|287/476| SEG 74->95|tdfrardataarnfgtaaaaag| SEG 102->112|lgglgddnddl| BL:PDB:NREP 1 BL:PDB:REP 3->73|2iodD|2e-06|38.0|71/321| RP:PDB:NREP 1 RP:PDB:REP 3->288|3c1oA|4e-13|11.3|284/314| RP:PFM:NREP 1 RP:PFM:REP 3->230|PF05368|2e-08|29.1|213/234|NmrA| HM:PFM:NREP 1 HM:PFM:REP 3->142|PF05368|1.5e-13|33.1|133/233|NmrA| RP:SCP:NREP 1 RP:SCP:REP 3->203|1xq6A|1e-22|23.3|193/253|c.2.1.2| HM:SCP:REP 1->288|1qydA_|2.5e-47|29.6|284/312|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 237 OP:NHOMOORG 210 OP:PATTERN ------------------------32212121-----------------------------------1 --2-2-11111----11----2--22-----122221111-1111111-11111111-----1-2--121-----------------------------1-11111--2----------------------------------------1------------------------------------11-----------------------------------11--------1---------------111---------------------------------------------------------------------------------------------------------------------------1-----------------------111111111-------1--------------------1--------------------1------------------------------------------------11-1--------------------1-1-----------11--------1111-------------1-312111-11111-2221-12111111---3---------------------------11--------1----------------------1-1-------1-1111-1111111111-111111111111111111111111--1111111111111111111111111--111111111111-------------------------------------------------------------------------1111111111111----------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 290 STR:RPRED 97.3 SQ:SECSTR ccEEEETTTcTTHHHHHHHHHHTTccEEEEEccccTTccHHEEEEccTTcHHHHHHHHTTccEEEEcccGEcGGcGGGHHHHHHHHHHccccEEEcccccccGGGccccHHHHHHHHHHHHHHHHHHHHTcccEEEEccEEHHHHHHHHHcccccccTTccEEEETTcccEEEEEcHHHHHHHHHHHHHcGGGTTEEEcccGGGEEEHHHHHHHHHHHHTccccEEEEcHHHHHHHHHHccTTTHHHHHHHHHHHcTTTccccccccGGGTcTTcccccHHHHHHHHHcc######## DISOP:02AL 296-298| PSIPRED cEEEEEccccHHHHHHHHHHHHcccEEEEEEccccccccccEEEEEccccHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHHHHccccEEEEcccEEEccccccHHHHHHHHHHccccEEEccccccccEEEHHHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHcccccccccHHHHHHHHccccccHHHHHHHcccccccHHHHHHHHHHHHHHHcccc //