[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56050.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:65 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 11->58 GATC_PELPD 5e-04 31.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56050.1 GT:GENE BAD56050.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1336549..1336746 GB:FROM 1336549 GB:TO 1336746 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56050.1 LENGTH 65 SQ:AASEQ MGDRSTARPPARVAELSAFARLPLPDERHDIVGAALDSVYGEIDRLRELELGDTPPATAFDARWR GT:EXON 1|1-65:0| BL:SWS:NREP 1 BL:SWS:REP 11->58|GATC_PELPD|5e-04|31.2|48/95| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10| PSIPRED ccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccc //