[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56052.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:222 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   44->159 PF01794 * Ferric_reduct 4.3e-12 24.1 116/125  
:BLT:SWISS 47->184 Y1462_ARCFU 2e-09 27.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56052.1 GT:GENE BAD56052.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1338441..1339109 GB:FROM 1338441 GB:TO 1339109 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56052.1 LENGTH 222 SQ:AASEQ MSVVVRGIGWITLYVAVAVVPLIFAVVGPVEGGRGFWVEFSVALGFVGMSMLGAQFALVARFRSMAAPFGEDALVQFHRQISAVALAFVLAHPVLLQIGGIDIVALLNLAEAPWRARFAVTSTVLLLIVVATSVWRRRLRIRYEVWQVMHGVLSVAVVGFALGHMLLVGYYLDAVWKVWLWVAMTLALVGLLVWVRVWRPSGGCGGRGASRRSPPNAVMPPP GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 47->184|Y1462_ARCFU|2e-09|27.0|137/100| TM:NTM 6 TM:REGION 6->28| TM:REGION 37->59| TM:REGION 86->108| TM:REGION 117->135| TM:REGION 148->170| TM:REGION 177->198| SEG 186->215|lalvgllvwvrvwrpsggcggrgasrrspp| HM:PFM:NREP 1 HM:PFM:REP 44->159|PF01794|4.3e-12|24.1|116/125|Ferric_reduct| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1----------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 204-222| PSIPRED ccEEHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcHHEEEEccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccc //