[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56054.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:402 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->39 PF06469 * DUF1088 0.00015 52.2 23/169  
:HMM:PFM   157->186 PF03475 * 3-alpha 0.00046 26.7 30/47  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56054.1 GT:GENE BAD56054.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1339743..1340951) GB:FROM 1339743 GB:TO 1340951 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56054.1 LENGTH 402 SQ:AASEQ MAHDIAAEDTAAIRRPIRRRTRVVRNAYGSAAAEAFLIIAITTILVTRLYLALTNYPQVGGGSLHIAHALYGGAAMMVALLVGWLVLGETARGVAVLIGGIGFGLFLDEVGKFVTADNDYFYGPAAEIMYVLVLVVLVANRAVRLVRAPTVEEYLANAAAIAAAGAAGGLPEHRRAAAERMLARAELGGADPRAVRGVRLLLDSAGHRVDRLYAVRQRLPRLVPAMFRSPRWVPVLGWLLVVSAAVGIAVGILQLALGGLELDTADTTLDIGRMGIAEAILFTSACLTFLVAAPAIVRYRPDGPLWPLHALRIAALIFTVLNAFADFATEGFGALVGVALGLFTMAMLSYRIGVRLGGQTLPGSGQGEPEPEAGREQEHGDHPHGAGGVGVAHDGASRVRRR GT:EXON 1|1-402:0| TM:NTM 8 TM:REGION 31->53| TM:REGION 67->89| TM:REGION 92->114| TM:REGION 121->143| TM:REGION 236->258| TM:REGION 276->298| TM:REGION 305->327| TM:REGION 329->351| SEG 10->25|taairrpirrrtrvvr| SEG 97->107|liggigfglfl| SEG 131->148|vlvlvvlvanravrlvra| SEG 156->169|anaaaiaaagaagg| SEG 174->187|rraaaermlarael| SEG 239->253|llvvsaavgiavgil| SEG 331->343|gfgalvgvalglf| SEG 379->396|hgdhphgaggvgvahdga| HM:PFM:NREP 2 HM:PFM:REP 17->39|PF06469|0.00015|52.2|23/169|DUF1088| HM:PFM:REP 157->186|PF03475|0.00046|26.7|30/47|3-alpha| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN ------------------------------------------------1------------------- -------------------------1-------1111111----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 360-384, 396-402| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccEEcccccccccccccccccccccccccccccccccccHHHHccc //