[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56055.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  204/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:197 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->195 3dhnA PDBj 2e-21 35.1 %
:RPS:PDB   1->155 3d5tA PDBj 2e-07 12.3 %
:RPS:SCOP  1->197 1hdoA  c.2.1.2 * 4e-12 14.1 %
:HMM:SCOP  1->199 1hdoA_ c.2.1.2 * 9.6e-28 33.7 %
:HMM:PFM   3->61 PF01370 * Epimerase 1.6e-08 35.6 59/238  
:BLT:SWISS 1->40 D39U1_MOUSE 5e-06 45.0 %
:BLT:SWISS 16->197 YWNB_BACSU 2e-22 39.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56055.1 GT:GENE BAD56055.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1341024..1341617) GB:FROM 1341024 GB:TO 1341617 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56055.1 LENGTH 197 SQ:AASEQ MKIAVFGATGMVGSAIVDEGRSRGHEVRTVSSRPGAADVTADLTRFEDVAGLAEEVDAIVVSVPPSRTGGSHEPWVAAHERLARTPLPTRLVLVGGAGSTLVEGTPLLQTPDFPADYLPEATSAARVLELFRAADAGVDWTILSPAPVIAPGERTGNYRLGGDELVGERVSTQDYAVALWDELEQPKHRRTRFTVAN GT:EXON 1|1-197:0| BL:SWS:NREP 2 BL:SWS:REP 1->40|D39U1_MOUSE|5e-06|45.0|40/308| BL:SWS:REP 16->197|YWNB_BACSU|2e-22|39.4|180/213| BL:PDB:NREP 1 BL:PDB:REP 2->195|3dhnA|2e-21|35.1|188/210| RP:PDB:NREP 1 RP:PDB:REP 1->155|3d5tA|2e-07|12.3|155/321| HM:PFM:NREP 1 HM:PFM:REP 3->61|PF01370|1.6e-08|35.6|59/238|Epimerase| RP:SCP:NREP 1 RP:SCP:REP 1->197|1hdoA|4e-12|14.1|191/205|c.2.1.2| HM:SCP:REP 1->199|1hdoA_|9.6e-28|33.7|190/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 217 OP:NHOMOORG 206 OP:PATTERN -----------------------------1-------------------------------------- ----31-1------1---------------------21---1-3--------1-1--1--11----12---------1---1------111----------1---1-1---------------------------------------------------------------------------11--------21111111111111111-1111111---1-1-11111222---------------1---11---11-------------1--11-1----------11111111111-------------111---111------1111111-1--------------------------------------------------111------------------1------1---1--111--1---1111--------------------------1--1-------------------------------11---11-11111111111111111111111111111----1---111-1-1--1--1--1-------------------------------------------------1-----------------------111---1-1---111-11-111111-11-----------------11--1----------------------------------1-------------------1------------------------------------------1-----------------1-----1111111111111------------------11111--11111------------------------------1-1------------------1-----------------1- -------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 196 STR:RPRED 99.5 SQ:SECSTR EEEEEccTTcHHHHHHHHHHHTTTTTcTTccEETTccTTEEEEEEEccHHHHHTTccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHccTTcEEEEccccHHHHHHHHHHTcTTccGGGEEEccHHHHHHHHHHTccGGGccccEEEccccTTcETcEEETTEEcccccHHHHHHHHHHHHHHHHHHTEEEEEc# PSIPRED cEEEEEccccHHHHHHHHHHHHcccEEEEEEEcccccEEEEccccHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHccccccccEEEEcccccccccccHHHHHHHHHHHHHcccccccEEEEcc //