[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56056.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  449/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->103 1yyvB PDBj 6e-17 47.1 %
:RPS:PDB   10->103 2d1hA PDBj 1e-09 14.0 %
:RPS:SCOP  11->103 1z7uA1  a.4.5.69 * 4e-27 36.6 %
:HMM:SCOP  7->121 2f2eA1 a.4.5.69 * 1.3e-33 39.8 %
:RPS:PFM   22->103 PF01638 * HxlR 3e-20 54.9 %
:HMM:PFM   23->109 PF01638 * HxlR 1.2e-28 43.7 87/91  
:BLT:SWISS 14->103 YTFH_SHIFL 1e-20 44.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56056.1 GT:GENE BAD56056.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1341703..1342077 GB:FROM 1341703 GB:TO 1342077 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56056.1 LENGTH 124 SQ:AASEQ MESDLVYDVMDPDCPSRPILQRLGGKWSMLVLQALADGPLRFTGLRATVAGITPKVLTQTLTNLERDGLLTRTHYPEIPPRVEYALTPLGRDALVPLIAMRRWAEANAPAIRAAQQAYDARDDG GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 14->103|YTFH_SHIFL|1e-20|44.4|90/126| SEG 104->120|aeanapairaaqqayda| BL:PDB:NREP 1 BL:PDB:REP 14->103|1yyvB|6e-17|47.1|85/107| RP:PDB:NREP 1 RP:PDB:REP 10->103|2d1hA|1e-09|14.0|93/98| RP:PFM:NREP 1 RP:PFM:REP 22->103|PF01638|3e-20|54.9|82/91|HxlR| HM:PFM:NREP 1 HM:PFM:REP 23->109|PF01638|1.2e-28|43.7|87/91|HxlR| RP:SCP:NREP 1 RP:SCP:REP 11->103|1z7uA1|4e-27|36.6|93/108|a.4.5.69| HM:SCP:REP 7->121|2f2eA1|1.3e-33|39.8|113/0|a.4.5.69|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1109 OP:NHOMOORG 468 OP:PATTERN 11-----------------------1111-----1----1---48--2--221--------------- 2---A--2222---1---------14-----1-1115232-94D32-1-11-311--2--211-6-5A86--111-11--121-1-1-1211-12------5---J48-1----------------------------------113-1322---111-----11-21221---------------22--1213888889483497678355554717--15-332111129G---------------1----2-2--------3211--322-1-233---------1------------1-11--11111--11---11111--7D2223222141-4111-1121----1---341------1---2-212-1244------44444--13212-----------4-23242427161-B664861788235251--231--1-1211111111-334---2-----------------------------1-3122-1111456383233332241333333523-252----51-1--21-11--1--1112------------1-111-1111-31111-11---11111---11-12-11-2121-1-1--------2---221-11--1----------2-----------1-------------2137-3-1111111111-111111111111111111123264--11111--1---11111121111111--211111111111---------1111--522---211-----1--144545-2--1-111-12224-1-1--123-------------1-----1----32131321111111---1----------------1----1-------------------------------12 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------3-----------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 83.1 SQ:SECSTR ccccccTTHGGGGHHHHHHHHTccHHHHHHHHHHHHcccEEHHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEcccEEEEEcTTHHHHHHHHHHHHHHHHTT##################### DISOP:02AL 1-2, 116-124| PSIPRED cccccccccccccccHHHHHHHHHcHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHcccEEEEEccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //