[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56060.1
DDBJ      :             putative ferredoxin reductase
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  262/915 : Eukaryota  50/199 : Viruses  0/175   --->[See Alignment]
c.3.1d.87.1
:408 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->402 3fg2P PDBj 5e-54 34.4 %
:RPS:PDB   2->403 1d7yA PDBj 2e-31 30.0 %
:RPS:SCOP  91->312 1gv4A1  c.3.1.5 * 7e-12 13.0 %
:RPS:SCOP  312->407 1q1rA3  d.87.1.1 * 2e-24 28.1 %
:HMM:SCOP  1->189 1gv4A1 c.3.1.5 * 9.1e-41 38.8 %
:HMM:SCOP  138->308 1d7yA1 c.3.1.5 * 4.4e-32 36.9 %
:HMM:SCOP  309->405 1q1rA3 d.87.1.1 * 2.2e-26 41.2 %
:HMM:PFM   2->277 PF07992 * Pyr_redox_2 3.1e-41 38.7 194/202  
:BLT:SWISS 1->402 THCD_RHOER 6e-74 43.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56060.1 GT:GENE BAD56060.1 GT:PRODUCT putative ferredoxin reductase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1344808..1346034 GB:FROM 1344808 GB:TO 1346034 GB:DIRECTION + GB:PRODUCT putative ferredoxin reductase GB:PROTEIN_ID BAD56060.1 LENGTH 408 SQ:AASEQ MVIVGAGHAGVQVADALRAGGHTGPLTLVGDEPCLPYQRPPLSKEHLAAESGAEPLPLRGARYFADHGIDLRTGTAAVAVDRRARLVGLADGREIGYDALVLATGSVNRPLRVPGAELAGVHALRTLADARALRGALATASAVLVVGAGFVGLEFAAVARARGLPVTVLDAGSRPLARAVSEPISAHVAAAHRAAGIDLRLGESVARFVGADGRVRGAVGTGGTEYRADLVLVGIGAVPRVELAERAGLAVADGIVVDGRLRTADPAIYAVGDCAAHPHPHAGTRIRLESVQNATDQARHVAAGLLGAEHDYADLPWFWSHQGAVKVQIAGLRRPGDDTVTLGDPATGRFSVCCLREGDLVAVESVGRPADHMAARRLLAAGPVPAPPDLTDPAFSLKRCAAALAPAR GT:EXON 1|1-408:0| BL:SWS:NREP 1 BL:SWS:REP 1->402|THCD_RHOER|6e-74|43.5|402/427| TM:NTM 2 TM:REGION 1->23| TM:REGION 135->157| SEG 72->90|rtgtaavavdrrarlvgla| SEG 123->159|alrtladaralrgalatasavlvvgagfvglefaava| SEG 186->195|ahvaaahraa| SEG 205->223|varfvgadgrvrgavgtgg| BL:PDB:NREP 1 BL:PDB:REP 1->402|3fg2P|5e-54|34.4|401/404| RP:PDB:NREP 1 RP:PDB:REP 2->403|1d7yA|2e-31|30.0|393/401| HM:PFM:NREP 1 HM:PFM:REP 2->277|PF07992|3.1e-41|38.7|194/202|Pyr_redox_2| RP:SCP:NREP 2 RP:SCP:REP 91->312|1gv4A1|7e-12|13.0|207/224|c.3.1.5| RP:SCP:REP 312->407|1q1rA3|2e-24|28.1|96/103|d.87.1.1| HM:SCP:REP 1->189|1gv4A1|9.1e-41|38.8|188/0|c.3.1.5|1/2|FAD/NAD(P)-binding domain| HM:SCP:REP 138->308|1d7yA1|4.4e-32|36.9|168/184|c.3.1.5|2/2|FAD/NAD(P)-binding domain| HM:SCP:REP 309->405|1q1rA3|2.2e-26|41.2|97/103|d.87.1.1|1/1|FAD/NAD-linked reductases, dimerisation (C-terminal) domain| OP:NHOMO 659 OP:NHOMOORG 327 OP:PATTERN ------1-11122211-----------------------------------1---11-111------- --1141-1222---42222-24--23222221666645FI1211112--1--2-4-1-----712385423-----------1--------------------------------------------------------------1----------------------------------------------------------------1---------------------1----------------------1--------11-------------------------------------------------------------------------1-------1-------1--1--1---1----------4112-----433223211112211111-11111-22322355-31-222233622344144112231111111---------11--3--------------------------------1231-443223443541444455344444145191541-111112-11222131------1---------11122-1---11---1---------11---1--11--1-------------------------11----2---1-------------------------1----------1----111-1---11-11111---111-111111-1---111-----------------2-----11---------------------------13-2----------------11111-2---1-1111--21211311121---------------------------1211---------------------------------------------------------------11- ------1-----111------------------1-----------------1-1----1------------------------------121-111------1----1--212111-1----1132-2-6A2-2-2------121----------11------111---2---1-1-----1--2--13-52------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 405 STR:RPRED 99.3 SQ:SECSTR HEEEcccHHHHHHHHHHHHHTccccEEEEEcccccccccGGGGTTHHccGGHHccGGGccccGGGcTTcEEEETccEEEEETTTTEEEETTccEEEccEEEEcccEEEcccGGGTTccccEEEcccHHHHHHHHHHccTTcEEEEEcccHHHHHHHHHHHHTTcEEEEEEccccTTTTTccHHHHHHHHHHHHTTTcEEEEcccEEEEETTEEEETTcETTcccEEEccEEEEcccEEEccHHHHHTTccccccEEccTTcccccTTEEEcGGGEEEEcTTTccEEEcccHHHHHHHHHHHHHHHHcTTcccccccEEEEEETTEEEEEEEcccccEEEEEEccccccEEEEEEEETTEEEEEEEEccHHHHHHHHHHHHTTccccHHHHHccccHHHHHHHcHH### DISOP:02AL 405-408| PSIPRED cEEEcccHHHHHHHHHHHHcccccEEEEEEcccccccccccccHHHHHccccHHHHEEccHHHHHHcccEEEEccEEEEEcccEEEEEEccccEEEEEEEEEEcccEEccccccccccccEEEEccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEEccccEEEEEEEEEEEccEEcHHHHHHccEEEccEEEEccccccccccEEEEEEEEcccccccccEEEcccHHHHHHHHHHHHHHHcccccccccccEEEEEEcccEEEEEEEcccccEEEEEEcccccEEEEEEEEccEEEEEEEEccHHHHHHHHHHHHccccccHHHHccccccHHHHHHHHcccc //