[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56064.1
DDBJ      :             putative oxygenase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:430 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->399 1k0iA1 c.3.1.2 * 2.7e-15 19.7 %
:RPS:PFM   199->249 PF00209 * SNF 6e-04 35.3 %
:HMM:PFM   4->46 PF07992 * Pyr_redox_2 3.9e-07 31.0 42/202  
:BLT:SWISS 49->186 RPC3_COCIM 1e-04 29.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56064.1 GT:GENE BAD56064.1 GT:PRODUCT putative oxygenase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1351193..1352485 GB:FROM 1351193 GB:TO 1352485 GB:DIRECTION + GB:PRODUCT putative oxygenase GB:PROTEIN_ID BAD56064.1 LENGTH 430 SQ:AASEQ MRSIAIIGAGQGGLQLAFGLLRDGYDVTVYSERTPEQIACSRFPSSAGIFAHALDHERALDICFWDGERPLIDHTFATVTDPEGTVAIQFQARFAKHGQSVDQRLKFSTWLEAFADRGGKVVYGAVDPDRLDDIAAIHDLTVVAAGKGDIARIFPLDRTRTVHDRPQRSIGLIALVGTEHPDSDGVCYNIRPGVGEAFGIPMLTAAGPGVAWVMEALPGGPMDRWAQATTAQEMLDLTRRTFADFFPWESARYADAEISDPNGWLCGAVPPLVREPIATLPSGRKVLGMADVVVLNDPACGQGANNASHHAAVVHRMILDQGSGPFDDRWMRATFDQAWERAEYATNFTNAMLAFNTPGAAPPAHAVDLLTTAARVPEVANRFCNAFSDPTDLRNYFFDPELTARFLAEATARHELRMRRRHDGVVGAPA GT:EXON 1|1-430:0| BL:SWS:NREP 1 BL:SWS:REP 49->186|RPC3_COCIM|1e-04|29.4|126/653| SEG 4->21|iaiigagqgglqlafgll| SEG 304->315|annashhaavvh| RP:PFM:NREP 1 RP:PFM:REP 199->249|PF00209|6e-04|35.3|51/352|SNF| HM:PFM:NREP 1 HM:PFM:REP 4->46|PF07992|3.9e-07|31.0|42/202|Pyr_redox_2| GO:PFM:NREP 4 GO:PFM GO:0005328|"GO:neurotransmitter:sodium symporter activity"|PF00209|IPR000175| GO:PFM GO:0005887|"GO:integral to plasma membrane"|PF00209|IPR000175| GO:PFM GO:0006836|"GO:neurotransmitter transport"|PF00209|IPR000175| GO:PFM GO:0016020|"GO:membrane"|PF00209|IPR000175| HM:SCP:REP 1->399|1k0iA1|2.7e-15|19.7|274/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 54 OP:NHOMOORG 44 OP:PATTERN -------------------------------------------------------------------- --------------1----------1----------6-3--1-1--------2-------1-----1111-------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------1------------------------------------------------------------------------------------------------------------1111111--------------11-1111----1-----1-------------------------21----------------------------12--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-1---1----------------------------------------------------------------11------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 424-425| PSIPRED ccEEEEEcccHHHHHHHHHHHHcccEEEEEEcccHHHHHcccccccccccHHHHHHHHHHccccccHHcccccEEEEEcccccccEEEEEccccccccccccHHHHHHHHHHHHHHcccEEEEEcccccHHHcccccccEEEEccccccHHHHccccccccccccccHHHEEEEEEcccccccccEEEEEEcccHHHEEcccccccccEEEEEEEccccccccHHcccccHHHHHHHHHHHHHHHccccHHHHHHccccccHHHHccccccEEEcccccccccEEEEEEccEEEEcccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHcccccccccccccccHHHHHHHHHHHHcHHHHHHHHHccccccccc //