[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56067.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  40/68 : Bacteria  686/915 : Eukaryota  40/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:210 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   60->199 2zwrB PDBj 2e-24 43.9 %
:RPS:PDB   8->203 1bmiB PDBj 1e-19 14.8 %
:RPS:SCOP  15->209 1qh3A  d.157.1.2 * 2e-18 21.9 %
:HMM:SCOP  1->208 1dd6A_ d.157.1.1 * 5.7e-41 33.0 %
:RPS:PFM   51->156 PF00753 * Lactamase_B 1e-10 42.7 %
:HMM:PFM   25->189 PF00753 * Lactamase_B 6.5e-33 28.0 164/194  
:BLT:SWISS 56->198 YQGX_BACSU 8e-20 38.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56067.1 GT:GENE BAD56067.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1354535..1355167) GB:FROM 1354535 GB:TO 1355167 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56067.1 LENGTH 210 SQ:AASEQ MSGALRIDRVVTSGVFELDGGSWNVDNNVWLIGDDDEVVVVDAAHEAAPILAGIGGRNVVAIVCTHGHNDHVTHAPQLSADLDAPLLLHPGDEPLWQLTHPGRSYGSLTDDQRIAVAGTDIQVIHTPGHSPGSVCLYLPEAGALFSGDTLFAGGPGATGRSFSDFPTIIDSIRDRVLTLPEETRVHTGHGDATTVGTEAPHLAEWIARGY GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 56->198|YQGX_BACSU|8e-20|38.7|142/211| SEG 34->48|dddevvvvdaaheaa| BL:PDB:NREP 1 BL:PDB:REP 60->199|2zwrB|2e-24|43.9|139/207| RP:PDB:NREP 1 RP:PDB:REP 8->203|1bmiB|1e-19|14.8|196/230| RP:PFM:NREP 1 RP:PFM:REP 51->156|PF00753|1e-10|42.7|103/171|Lactamase_B| HM:PFM:NREP 1 HM:PFM:REP 25->189|PF00753|6.5e-33|28.0|164/194|Lactamase_B| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00753|IPR001279| RP:SCP:NREP 1 RP:SCP:REP 15->209|1qh3A|2e-18|21.9|183/260|d.157.1.2| HM:SCP:REP 1->208|1dd6A_|5.7e-41|33.0|203/216|d.157.1.1|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 1171 OP:NHOMOORG 766 OP:PATTERN 11-----11---1112--11111115311212-----------12111112111111---1---1-11 1112332444433334444-4333434444443434245522323-22-11-433232--22225573334-------1113311111111111221--2-11-131211--------------11-11111-1-1---111112111122211111----1-11211111------------12122--1212111111111121111113312111111121111111111111111111111111111111----------------------111111111111111111111111111-111111111111111111112111111122111111221111111--11111111111111111111--11-211112221121211112122122222222222-221221311121122211211122221111-1----------------1111122------------------------------325111----1222112222211112222221112223-1221111222-212121332-1121111111-1-112-31311111221111111111112111113421111-1111111-11111111-111---2111211-1112222-21111111111111--2212------11121212222222222-2222222222222222222222221112222222222122222122222221-22222222222211-------1111121--111111111111111223223211-2121121221222221111---------322212222222211--11111-1-1111--1111------------1-1--------------------------1---1--11231 -----1-----1--31--1-1------------1---------------1------------------------------------1------1-111----1-----1-2------------------------------------------111--11-11--1--132---1--1-2--11-1123241------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 210 STR:RPRED 100.0 SQ:SECSTR TTccEEETTEEEEEEEEEETTTEEEEEEEEEEEETTEEEEEcccccHHHHHHHHHccEEEEEEcccccHHHHTTHHHHHHTTcEEEEEHHHHHHHHHTTcccccEEEccEEEEEETTEEEEEEcccccccTTccEEEETTTTEEEEETTcccTTcccccccTTcTTTHHHHHHHHHHHcTTccEEEEcccccccTHHHHHHHHHHHHHcE DISOP:02AL 1-3| PSIPRED ccccccccEEEcccEEEEccEEEEcccEEEEEEEccEEEEEEccccHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHccccEEEcccHHHHHHccccccccEEEccccEEEEccEEEEEEEEEccccccEEEEEccccEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHccc //