[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56070.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  420/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.190.1
:251 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->94 2di3B PDBj 3e-08 34.7 %
:BLT:PDB   110->248 2pkhB PDBj 3e-44 61.6 %
:RPS:PDB   24->117 3by6D PDBj 4e-16 19.1 %
:RPS:PDB   96->248 3cnvC PDBj 5e-25 19.2 %
:RPS:SCOP  24->93 1e2xA1  a.4.5.6 * 3e-15 25.7 %
:RPS:SCOP  111->248 2pkhA1  d.190.1.2 * 2e-23 61.3 %
:HMM:SCOP  14->123 1v4rA1 a.4.5.6 * 8.9e-17 31.0 %
:HMM:SCOP  95->248 2fa1A1 d.190.1.2 * 2.9e-29 29.4 %
:RPS:PFM   24->86 PF00392 * GntR 2e-07 49.2 %
:RPS:PFM   115->228 PF07702 * UTRA 2e-06 33.6 %
:HMM:PFM   108->241 PF07702 * UTRA 8e-27 29.1 134/141  
:HMM:PFM   24->86 PF00392 * GntR 6.3e-22 46.0 63/64  
:BLT:SWISS 24->248 HUTC_PSEAE 5e-77 63.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56070.1 GT:GENE BAD56070.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1357696..1358451) GB:FROM 1357696 GB:TO 1358451 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56070.1 LENGTH 251 SQ:AASEQ MAIEVVDAELAAVYDALGSEFAAYERVKQLIVSQIKGGRWREGDQIPSENQLVSALGLSRMTINRALRDLTAEGVLNRVMGVGTFVAPTKAASPLFEVKNIADEIQQRGHRHRTEVVFVRSEHAEIGHPVLGDALGGNVFHSLIVHFEDDVPIQVEDRYVNPAEAPHYLEQDFTTTTPNTYLSAVAPLERGEHVVEAVLAAPEECRLLGVPRSEPCLLIRRRTWSATGLVSAARLIHPGSRSRLEGSFGPS GT:EXON 1|1-251:0| BL:SWS:NREP 1 BL:SWS:REP 24->248|HUTC_PSEAE|5e-77|63.1|225/250| BL:PDB:NREP 2 BL:PDB:REP 23->94|2di3B|3e-08|34.7|72/230| BL:PDB:REP 110->248|2pkhB|3e-44|61.6|138/140| RP:PDB:NREP 2 RP:PDB:REP 24->117|3by6D|4e-16|19.1|94/121| RP:PDB:REP 96->248|3cnvC|5e-25|19.2|151/158| RP:PFM:NREP 2 RP:PFM:REP 24->86|PF00392|2e-07|49.2|59/64|GntR| RP:PFM:REP 115->228|PF07702|2e-06|33.6|110/141|UTRA| HM:PFM:NREP 2 HM:PFM:REP 108->241|PF07702|8e-27|29.1|134/141|UTRA| HM:PFM:REP 24->86|PF00392|6.3e-22|46.0|63/64|GntR| GO:PFM:NREP 6 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| GO:PFM GO:0003677|"GO:DNA binding"|PF07702|IPR011663| GO:PFM GO:0030528|"GO:transcription regulator activity"|PF07702|IPR011663| GO:PFM GO:0045449|"GO:regulation of transcription"|PF07702|IPR011663| RP:SCP:NREP 2 RP:SCP:REP 24->93|1e2xA1|3e-15|25.7|70/73|a.4.5.6| RP:SCP:REP 111->248|2pkhA1|2e-23|61.3|137/141|d.190.1.2| HM:SCP:REP 14->123|1v4rA1|8.9e-17|31.0|100/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 95->248|2fa1A1|2.9e-29|29.4|153/0|d.190.1.2|1/1|Chorismate lyase-like| OP:NHOMO 774 OP:NHOMOORG 421 OP:PATTERN -------------------------------------------------------------------- 11214211------111----1--21-----23-1-24231----1---11-212--1--2122313132--------1---2--------------------------------------------------------1-------------------------------------------331-----1-3111--1221-----14222141111122222111111----------------------311-12-111211111111112-1111111112111-1111111111-------------12111122211--111111111-1-11---111-----1----11-1--2--1-11-1-----4222-------111--------33333332336---2--2--22--4443352545451--11--31---123--------1111--11--------------------------------12-154417777772222266652222238666542--221112--2-2221321-11-2-----------11--11-----------------1-11----1------------------------------11-1--112121111-11111111111111------1------2211-11222222-233-222321-3232212222221121-11-4224233444244443122-22221-111-11111111---1-----------2-3---------------222221--11-12212212212112-111----------111111111112111111111111---------------------------------------------------21---2---1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 248 STR:RPRED 98.8 SQ:SECSTR HHHHHHHHHHHHHHHTTcccHccHHHHHHHHHHHHHHTcccTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcccEEEccccEcccccccccccEEEcccccccccEEEEEEEEEEEccHHHHHTTccTTcEEEEEEEEEEEETTEEEEEEEEEETGGGTTccHHHHHHccccHHHHHHccccEEEEEEEEEEccTTTHHHHTccTTcEEEEEEEEEEETTTEEEEEEEEEccccEEEcccc### DISOP:02AL 1-3, 9-21, 250-251| PSIPRED cccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcccEEEEcccccHHHHHHcccHHHHHHHccccccEEEEEEEEcccHHHHHHHcccccccEEEEEEEEEEccEEEEEEEEcccHHHHHHHHHHHHHcccHHHHHHHcccEEEEEEEEEEEEccHHHHHHHcccccccEEEEEEEEEccccEEEEEEEEEcccEEEEEEEEccc //