[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56080.1
DDBJ      :             putative arginase
Swiss-Prot:HUTG_NOCFA   RecName: Full=Formimidoylglutamase;         EC=3.5.3.8;AltName: Full=Formiminoglutamase;AltName: Full=Formiminoglutamate hydrolase;

Homologs  Archaea  2/68 : Bacteria  190/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.42.1
:310 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->296 1xfkA PDBj 5e-43 44.6 %
:RPS:PDB   36->305 2ef4A PDBj 6e-35 25.1 %
:RPS:SCOP  7->301 1xfkA  c.42.1.1 * 1e-68 39.5 %
:HMM:SCOP  6->305 1xfkA_ c.42.1.1 * 8.9e-70 36.1 %
:RPS:PFM   53->298 PF00491 * Arginase 1e-13 32.5 %
:HMM:PFM   36->300 PF00491 * Arginase 4.6e-58 34.0 253/274  
:BLT:SWISS 1->310 HUTG_NOCFA e-167 100.0 %
:PROS 231->252|PS01053|ARGINASE_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56080.1 GT:GENE BAD56080.1 GT:PRODUCT putative arginase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1373147..1374079 GB:FROM 1373147 GB:TO 1374079 GB:DIRECTION + GB:PRODUCT putative arginase GB:PROTEIN_ID BAD56080.1 LENGTH 310 SQ:AASEQ MRPAPRWTGRTDGTTDEHLRWHQVVAPYAPGAEPNSCVFVGFASDEGVRRNKGRVGAAAGPDALRQAMAPMALDRPRRAYDAGTVEVVGEALEEGQRALGGTVAGLLDAGHFPVVFGGGHEIAYGTYLGVAGSSRRAPGTRLGILNLDAHFDLRADPVPSSGTPFRQILAAEGDAVRYAVLGISQPSNTAALFDTAARFGVRHLPDDECDPATALAFVDAFLAEIDLVYLTIDLDVLPAAVAPGVSAPAAFGVPLPTLQAVCDRVSASGKLAVVDVAELNPGLDIDNRTARTAARLIHRIVTRHVPVPAG GT:EXON 1|1-310:0| SW:ID HUTG_NOCFA SW:DE RecName: Full=Formimidoylglutamase; EC=3.5.3.8;AltName: Full=Formiminoglutamase;AltName: Full=Formiminoglutamate hydrolase; SW:GN Name=hutG; OrderedLocusNames=NFA_12350; SW:KW Complete proteome; Histidine metabolism; Hydrolase; Manganese;Metal-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->310|HUTG_NOCFA|e-167|100.0|310/310| GO:SWS:NREP 3 GO:SWS GO:0006547|"GO:histidine metabolic process"|Histidine metabolism| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 231->252|PS01053|ARGINASE_1|PDOC00135| SEG 236->254|vlpaavapgvsapaafgvp| BL:PDB:NREP 1 BL:PDB:REP 7->296|1xfkA|5e-43|44.6|289/324| RP:PDB:NREP 1 RP:PDB:REP 36->305|2ef4A|6e-35|25.1|259/282| RP:PFM:NREP 1 RP:PFM:REP 53->298|PF00491|1e-13|32.5|234/266|Arginase| HM:PFM:NREP 1 HM:PFM:REP 36->300|PF00491|4.6e-58|34.0|253/274|Arginase| GO:PFM:NREP 2 GO:PFM GO:0016813|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines"|PF00491|IPR006035| GO:PFM GO:0046872|"GO:metal ion binding"|PF00491|IPR006035| RP:SCP:NREP 1 RP:SCP:REP 7->301|1xfkA|1e-68|39.5|294/324|c.42.1.1| HM:SCP:REP 6->305|1xfkA_|8.9e-70|36.1|299/0|c.42.1.1|1/1|Arginase/deacetylase| OP:NHOMO 198 OP:NHOMOORG 194 OP:PATTERN -------------------1------------------------------1----------------- -----1-1-------------------------1111111------11----11111-------------------------1----------------1----11---1--------------------------111-----------------------------------------------------1-11111-11111111111---11111111---------1-1111111111111111111------------------------------1---1-------------11111111111111---------------------------------1-----------------------1--------------------------111111111--------1-1-------1--1-------------------1------------------------------------------------1---1--1-------------1---------12111--221--1---1--1--------1-----------1--1----------------------------------------------------------11-1----1-1-----1------1--1--1-------------1----1--------------------1----------111--11-1111111111111111-------------------------------1111--1-----------------111111--11--1111-1--1------------------1112111111111111-----111--------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 301 STR:RPRED 97.1 SQ:SECSTR ######ccccccGGGGGGccHHHHEEcccccGGGcEEEEEEEccccccGGGTccccGGGHHHHHHHTTHHHHHHHHTEEEEEEEcccTTHHHHHHHHHHHHHHHHTccTTEEEEEEEccGGGHHHHHHHHHHHTTTTTTcccEEEEEccccccccTTTcccGcHHHHHTTccccHHHHHHHccccGcccHHHHHHHHHHTcEEEEHHHHHHHcHHHHHHHHHHHTccEEEEEEGGGccTTTcccccccccccccHHHHHHHHHHHHHHTcEEEEEEEcccTTTccTTHHHHHHHHHHHHHTTcccTc### DISOP:02AL 308-310| PSIPRED ccccccccccccccccccccccEEEcccccccccccEEEEEEccccccccccccccHHHHHHHHHHHHHcccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHcccEEEEHHHHccccHHHHHHHHHHHcccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHccccccc //