[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56085.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  49/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->90 1orvA PDBj 5e-04 22.1 %
:RPS:PDB   8->138 1cauA PDBj 6e-10 16.2 %
:RPS:SCOP  21->127 1pmiA  b.82.1.3 * 1e-11 12.4 %
:HMM:SCOP  7->127 1lrhA_ b.82.1.2 * 1.6e-19 33.3 %
:RPS:PFM   51->106 PF02311 * AraC_binding 5e-04 42.3 %
:HMM:PFM   52->121 PF07883 * Cupin_2 4e-13 25.8 66/71  
:BLT:SWISS 14->90 DPP4_BOVIN 3e-04 23.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56085.1 GT:GENE BAD56085.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1380583..1381023) GB:FROM 1380583 GB:TO 1381023 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56085.1 LENGTH 146 SQ:AASEQ MSNETLDTTAVPVVTPAGQEHTDTAQSGGAVRVSGVSPQHTPATRIWYGRVSNEPGYRSLPHHHGEAETGGYVLKGVARIYFGADYRQYVDMKEGDFVFVPPFMPHIEVNMSTTEELVWLTARTPDNIVVNLPDVDDAILAGYRRA GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 14->90|DPP4_BOVIN|3e-04|23.4|77/765| BL:PDB:NREP 1 BL:PDB:REP 14->90|1orvA|5e-04|22.1|77/728| RP:PDB:NREP 1 RP:PDB:REP 8->138|1cauA|6e-10|16.2|130/181| RP:PFM:NREP 1 RP:PFM:REP 51->106|PF02311|5e-04|42.3|52/130|AraC_binding| HM:PFM:NREP 1 HM:PFM:REP 52->121|PF07883|4e-13|25.8|66/71|Cupin_2| GO:PFM:NREP 1 GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02311|IPR003313| RP:SCP:NREP 1 RP:SCP:REP 21->127|1pmiA|1e-11|12.4|105/440|b.82.1.3| HM:SCP:REP 7->127|1lrhA_|1.6e-19|33.3|120/0|b.82.1.2|1/1|RmlC-like cupins| OP:NHOMO 61 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- --2-1----------11-------1------1----1--1-1----------1-------------1-----------------------------------------------------------------------------1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----1---------------22222221----2---21-1111111-----1------1---------------------------------------------------------------------11--------1-1------1-------1-1-------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------1-----------------------------------1-1------------------------------------------------------------ ----------------1---------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 146 STR:RPRED 100.0 SQ:SECSTR HHccccGccccccccccccEEEEEEETTEEEEEEcccTTccGTTTEEEEEEEEcccEEEEEEEcEccEEEEEEEEcEEEEEEEETTEEEEEEETTcEEEEcTTcEEEEEEccccccEEEEEEEEccccTTcccEEEccGGccHHHH DISOP:02AL 1-7, 145-146| PSIPRED ccccccccccccEEEEccccccccccccccEEEEEEcccccccEEEEEEEEEEccccccccEEEcccEEEEEEEEEEEEEEEccccEEEEEEccccEEEEccccEEEEEEccccccEEEEEEEcccccEEEccccHHHHHcccccc //