[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56095.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  34/199 : Viruses  0/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56095.1 GT:GENE BAD56095.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1392013..1392354 GB:FROM 1392013 GB:TO 1392354 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56095.1 LENGTH 113 SQ:AASEQ MIRPKGPPPRAPTSLSCNPPANASPPTRPHFADTVAARQGQPGRRRALSRFYAHHFAHSDPADTESIPISRMIGADRIVAEQLSCFTHDREIDWMLPGVAPTAAMGRCRWWRS GT:EXON 1|1-113:0| SEG 36->47|aarqgqpgrrra| OP:NHOMO 77 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1----------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------1-----------------------------------------------1113111------1-------2111111----------1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--1-----1111-------------------------------------------------------------------------------------------------------------- ----------------11121112313-1--------111-11--111--122211-11--1-----------------------------11-1-------1--------------------------------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13| PSIPRED ccccccccccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHcccccccccEEEEHHHHHHHHHHHHHHHHHccccEEcccccccccccHHHHccccccc //