[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56098.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:182 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   71->147 1xxlA PDBj 3e-05 32.5 %
:RPS:PDB   71->143 3e05B PDBj 2e-07 13.7 %
:RPS:SCOP  72->138 1xxlA  c.66.1.41 * 2e-10 31.3 %
:HMM:SCOP  22->143 1xxlA_ c.66.1.41 * 3e-16 36.7 %
:RPS:PFM   71->110 PF08241 * Methyltransf_11 3e-07 57.5 %
:RPS:PFM   87->129 PF08007 * Cupin_4 4e-04 40.0 %
:HMM:PFM   69->111 PF08241 * Methyltransf_11 2e-15 53.5 43/95  
:BLT:SWISS 71->117 YT37_STRFR 4e-06 46.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56098.1 GT:GENE BAD56098.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1394422..1394970) GB:FROM 1394422 GB:TO 1394970 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56098.1 LENGTH 182 SQ:AASEQ MADAAELRTARGLIGGLAGVLAVWDRVRVAGREPRILDVGCGETKQYPGNVGVDVRPVPGVDVVADLRGGLPFDDASFDRVFAVHVLEHLADFLPLVDECRRVLRPGGILHVLSPWWRYVNAVADPTHLRLLDVQTFKGICARDPAWYPLHAGCDGASIFADLENRGSPVTPDPVHLARFFD GT:EXON 1|1-182:0| BL:SWS:NREP 1 BL:SWS:REP 71->117|YT37_STRFR|4e-06|46.8|47/345| SEG 12->23|gligglagvlav| SEG 48->66|pgnvgvdvrpvpgvdvvad| BL:PDB:NREP 1 BL:PDB:REP 71->147|1xxlA|3e-05|32.5|77/231| RP:PDB:NREP 1 RP:PDB:REP 71->143|3e05B|2e-07|13.7|73/192| RP:PFM:NREP 2 RP:PFM:REP 71->110|PF08241|3e-07|57.5|40/96|Methyltransf_11| RP:PFM:REP 87->129|PF08007|4e-04|40.0|40/185|Cupin_4| HM:PFM:NREP 1 HM:PFM:REP 69->111|PF08241|2e-15|53.5|43/95|Methyltransf_11| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF08241|IPR013216| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF08241|IPR013216| RP:SCP:NREP 1 RP:SCP:REP 72->138|1xxlA|2e-10|31.3|67/234|c.66.1.41| HM:SCP:REP 22->143|1xxlA_|3e-16|36.7|120/0|c.66.1.41|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --1---------------------------------1-----------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 61.5 SQ:SECSTR ######################################################################TTTTcTTcccccEEEEcccTTcHHHHHHHHHHHccTTcEEEEHHHHHHHHHHTTcEEEEEEEccEEcccccccTccccccHHHHcEEEEEccccccEEEccGGGcTTccHHH DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHEEEEcccccccHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEccHHHHHHcccccEEEEccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccc //