[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56106.1
DDBJ      :             putative ABC transporter membrane protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  80/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:267 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   23->230 PF01061 * ABC2_membrane 8e-08 25.2 %
:HMM:PFM   23->230 PF01061 * ABC2_membrane 7.5e-26 23.7 198/208  
:HMM:PFM   205->260 PF04956 * TrbC 8e-06 26.7 45/100  
:BLT:SWISS 12->267 DRRB_STRPE 2e-21 25.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56106.1 GT:GENE BAD56106.1 GT:PRODUCT putative ABC transporter membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1413752..1414555) GB:FROM 1413752 GB:TO 1414555 GB:DIRECTION - GB:PRODUCT putative ABC transporter membrane protein GB:PROTEIN_ID BAD56106.1 LENGTH 267 SQ:AASEQ MTTATLPRPALPQRALRIAQDNLTMLDRNIRHTLRSPDTMIMTLALPIMILLMFVYVFGGAMNVGGGAYIDYVVPGIILLCAGFGASTTAVSISTDVADGIVDRFRTMSIARSAMLTGHVIESVIRNMITTGLVVVVAVALGFRPTADPVRWLGATALIALFVFALSWLAAALGLLARNPEAANGFTFVFMFLPYVSSAFVPTESMPTALHAFAENQPVTPVIETVRGLLMGTEIGGSAALAVAWCGGVAALGYLAARVLFRRRTAN GT:EXON 1|1-267:0| BL:SWS:NREP 1 BL:SWS:REP 12->267|DRRB_STRPE|2e-21|25.5|255/100| TM:NTM 6 TM:REGION 39->61| TM:REGION 71->93| TM:REGION 126->148| TM:REGION 153->175| TM:REGION 180->202| TM:REGION 230->252| SEG 130->142|ttglvvvvavalg| SEG 165->177|alswlaaalglla| RP:PFM:NREP 1 RP:PFM:REP 23->230|PF01061|8e-08|25.2|202/208|ABC2_membrane| HM:PFM:NREP 2 HM:PFM:REP 23->230|PF01061|7.5e-26|23.7|198/208|ABC2_membrane| HM:PFM:REP 205->260|PF04956|8e-06|26.7|45/100|TrbC| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF01061|IPR013525| OP:NHOMO 163 OP:NHOMOORG 88 OP:PATTERN --------11111-------------------------------1-----1-1--------------- ---17----------1-----2----------11119555152626-2-1--121--1--521-24246A------------------------------------------------------------------111----------------------------------------------------1--11111111-21111111----111-11----111111-3----------------------1--------11-----------11---------------------------------------------1---------------11---------------1------------------------------------------------------------1------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------11-1-----------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 264-267| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHcHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccc //