[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56109.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  44/68 : Bacteria  725/915 : Eukaryota  145/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->134 2cx3B PDBj 5e-22 46.7 %
:RPS:PDB   6->154 2bmxB PDBj 7e-27 20.4 %
:RPS:SCOP  2->140 1psqA  c.47.1.10 * 1e-33 29.0 %
:HMM:SCOP  2->154 1x0rA1 c.47.1.10 * 3e-52 40.0 %
:RPS:PFM   9->136 PF00578 * AhpC-TSA 1e-23 41.3 %
:HMM:PFM   8->135 PF00578 * AhpC-TSA 6e-43 40.2 122/124  
:BLT:SWISS 6->146 BCP_SHIFL 2e-40 50.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56109.1 GT:GENE BAD56109.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1416378..1416848) GB:FROM 1416378 GB:TO 1416848 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56109.1 LENGTH 156 SQ:AASEQ MTNQRLAPGDLAPAFTLPDADGNEVSLADYRGRKVVVYFYPAASTPGCTKQACDFRDNLAELEQAGIDVVGISPDKPAKLAKFRDAERLTFPLLSDPERTVLTEWGAYGEKTMYGKKVTGVIRSTFLVDEEGRIELAQYNVRATGHVAKLRRDLSV GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 6->146|BCP_SHIFL|2e-40|50.4|141/156| BL:PDB:NREP 1 BL:PDB:REP 9->134|2cx3B|5e-22|46.7|122/159| RP:PDB:NREP 1 RP:PDB:REP 6->154|2bmxB|7e-27|20.4|142/177| RP:PFM:NREP 1 RP:PFM:REP 9->136|PF00578|1e-23|41.3|121/122|AhpC-TSA| HM:PFM:NREP 1 HM:PFM:REP 8->135|PF00578|6e-43|40.2|122/124|AhpC-TSA| GO:PFM:NREP 2 GO:PFM GO:0016209|"GO:antioxidant activity"|PF00578|IPR000866| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00578|IPR000866| RP:SCP:NREP 1 RP:SCP:REP 2->140|1psqA|1e-33|29.0|131/163|c.47.1.10| HM:SCP:REP 2->154|1x0rA1|3e-52|40.0|145/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 1434 OP:NHOMOORG 914 OP:PATTERN 44--1-433333333312211---41133221------------1111-1212--1-1222332--22 3152311211111133333-331133333333433333331325112112223432131122213333332-111111---13212231121-1112--1-22217211211111111------122222122231111221114152653345655334443324455543324333334433342121-1121111111111211121111121112121111------22111111111111111111111---------------------------------------------------------------------11-11-------1-1-1---1111-1-1-111-----------111-2--3-111121111121111111212111111111-111-1111211211111111112111112311121-111111111111111123211111111111111141111-1111-11-111111121-1111222222221111223322222222211111111111111111111112342311111111111223232-----2-11221-21321231132143512111111111111111111111111111222113212111111112122221211212--112111-----11111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-211111111111112111111111111111222222411122111121121222211111----1---21111111111111111111111111111112-222233-------------------1--------1-------212222-22222- --11D6--------2-11111111111-111111111111111-1111111111111-1-1111111111111111111111111-11-21212221112-1231----1-1-11--1--111121-1-523-111---12-2111-1112--1211-1---1--1---------3322C111143112112224463- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 99.4 SQ:SECSTR cccccccccTTTcccccGGGGEEEEETTccTTcEEEEEEcccTTccccHHHHHHHHHcHHHHHTTTEEEEEEEcccHHHHHHHHHHcGGGTccEEcTTcHHHHHHTcccTTcccEEETTEEcEEEEEEcTTccEEEEEEcTTccccHHHHHHHHH# DISOP:02AL 1-4| PSIPRED ccccccccccccccEEEEcccccEEEHHHHcccEEEEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHccccEEEEEcccHHHHHHcccccccccccccccccccEEEEEccccEEEEEEEccccccHHHHHHHHHcc //