[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56110.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->49 PF12277 * DUF3618 2.7e-19 46.9 49/49  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56110.1 GT:GENE BAD56110.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1416994..1417215 GB:FROM 1416994 GB:TO 1417215 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56110.1 LENGTH 73 SQ:AASEQ MGRDTERIEREIEDARNRLASTLDEIAVRADPQRIADDTKSMVVAKLNEPKIKYGLIGAGALVVGLVLVKLFR GT:EXON 1|1-73:0| TM:NTM 1 TM:REGION 53->73| SEG 6->13|eriereie| SEG 55->69|gligagalvvglvlv| HM:PFM:NREP 1 HM:PFM:REP 1->49|PF12277|2.7e-19|46.9|49/49|DUF3618| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHc //