[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56111.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:118 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   81->115 PF05901 * Excalibur 4e-08 62.9 %
:HMM:PFM   80->115 PF05901 * Excalibur 9.1e-16 38.9 36/37  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56111.1 GT:GENE BAD56111.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1417282..1417638) GB:FROM 1417282 GB:TO 1417638 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56111.1 LENGTH 118 SQ:AASEQ MGAASHSRRRSTAADTEEYMNVRRLTVSAAVAGLTLLAAPAGQAAAVPTGSAGTGSSAIDTGLIMTGSAGLSQTGSAGGAFPNCDAARAAGRAPIFRGEPGYGPHLDPDGDGFACPTV GT:EXON 1|1-118:0| SEG 3->14|aashsrrrstaa| SEG 26->50|tvsaavagltllaapagqaaavptg| RP:PFM:NREP 1 RP:PFM:REP 81->115|PF05901|4e-08|62.9|35/37|Excalibur| HM:PFM:NREP 1 HM:PFM:REP 80->115|PF05901|9.1e-16|38.9|36/37|Excalibur| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------11111-1--1111-1------1--------------------------------------------------------------------------------------------------11---111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14| PSIPRED cccccccHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEcccccccccccccccccHHHHHHcccccccccccccHHcccccccEEccccc //