[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56112.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  83/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:176 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->158 2fbkA PDBj 7e-11 36.1 %
:RPS:PDB   19->118 3deuB PDBj 5e-14 15.2 %
:RPS:SCOP  18->130 1hsjA1  a.4.5.28 * 4e-18 13.3 %
:HMM:SCOP  15->154 1jgsA_ a.4.5.28 * 7.2e-30 27.5 %
:RPS:PFM   105->153 PF04989 * CmcI 3e-04 30.6 %
:HMM:PFM   46->104 PF01047 * MarR 1.2e-10 31.6 57/59  
:HMM:PFM   117->172 PF00294 * PfkB 0.00068 30.9 55/300  
:BLT:SWISS 29->154 MARR_SALTY 2e-08 28.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56112.1 GT:GENE BAD56112.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1417742..1418272 GB:FROM 1417742 GB:TO 1418272 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56112.1 LENGTH 176 SQ:AASEQ MSTKCARLDDVVRWLSDDEQQTWQAYIRIRQRMDAAIAAGLARDGLSLADYDLLVPLSAAPGGRMRAKELGAEVCWEKSRLSKHLARMAARGLVERRPSPEDARGIVVELTPAGRAVLERAAPNHVELVRSLFIDPMTPEQARALRELADRVVPEAEEATDLAASCDEDDSSRAAS GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 29->154|MARR_SALTY|2e-08|28.6|119/144| BL:PDB:NREP 1 BL:PDB:REP 42->158|2fbkA|7e-11|36.1|108/156| RP:PDB:NREP 1 RP:PDB:REP 19->118|3deuB|5e-14|15.2|99/130| RP:PFM:NREP 1 RP:PFM:REP 105->153|PF04989|3e-04|30.6|49/186|CmcI| HM:PFM:NREP 2 HM:PFM:REP 46->104|PF01047|1.2e-10|31.6|57/59|MarR| HM:PFM:REP 117->172|PF00294|0.00068|30.9|55/300|PfkB| GO:PFM:NREP 2 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF04989|IPR007072| GO:PFM GO:0008610|"GO:lipid biosynthetic process"|PF04989|IPR007072| RP:SCP:NREP 1 RP:SCP:REP 18->130|1hsjA1|4e-18|13.3|113/115|a.4.5.28| HM:SCP:REP 15->154|1jgsA_|7.2e-30|27.5|138/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 186 OP:NHOMOORG 83 OP:PATTERN -------------------------------------------------------------------- ---181122221111------2---5------34448546131553113223222411--1242A233573-----------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------11--11111-------------11-1131---------------11-------------------------------------------------------------------1111-11-1-------------------------------------------------------------------------------------1--1--------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------1--------1--------------------------------------------1111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 92.0 SQ:SECSTR ############ccHHHHcccHHHHHHHHHHHHHHHHHHHTGGGTccHHHHHHHHHHHTcHcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEcccEEcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcGGGc## DISOP:02AL 1-5, 8-10, 157-176| PSIPRED cccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccccccccccc //