[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56117.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  43/199 : Viruses  0/175   --->[See Alignment]
b.82.2
:287 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   152->230 3gjaB PDBj 8e-06 33.3 %
:RPS:PDB   19->240 2dbiA PDBj 5e-29 14.5 %
:RPS:SCOP  18->228 2a1xA1  b.82.2.9 * 1e-27 25.0 %
:HMM:SCOP  6->287 2a1xA1 b.82.2.9 * 3.3e-49 31.3 %
:RPS:PFM   24->214 PF05721 * PhyH 4e-16 38.2 %
:HMM:PFM   25->222 PF05721 * PhyH 7.9e-40 30.2 189/211  
:BLT:SWISS 24->287 Y3657_MYCBO 1e-19 31.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56117.1 GT:GENE BAD56117.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1422993..1423856) GB:FROM 1422993 GB:TO 1423856 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56117.1 LENGTH 287 SQ:AASEQ MTSVDATLQRVGNTTGITEIREIVDRDGGVIIEGLLTADQVARFNAQIEEPLAALTPGGKHELEIVNEFHGANTKRLTNLVTHSQVFREEVIDHDLVHALCEATFLEESGTFWMTTAQVIEIGPGNRAQMLHRDLENWFPFVGMGPAGPEVTVNFLIALTDFTEENGATRVIPGSNHWPDFQDRGTPDQTVPATMKAGDALFFSGKTAHGGGANITTDQYRRGLAFAFNPGYLVGEEAFPFLVDREVVKTLPERVQRILGFRSQYPLGSPGLWQVDYRELGEYLGLD GT:EXON 1|1-287:0| BL:SWS:NREP 1 BL:SWS:REP 24->287|Y3657_MYCBO|1e-19|31.6|250/291| BL:PDB:NREP 1 BL:PDB:REP 152->230|3gjaB|8e-06|33.3|78/273| RP:PDB:NREP 1 RP:PDB:REP 19->240|2dbiA|5e-29|14.5|221/397| RP:PFM:NREP 1 RP:PFM:REP 24->214|PF05721|4e-16|38.2|178/204|PhyH| HM:PFM:NREP 1 HM:PFM:REP 25->222|PF05721|7.9e-40|30.2|189/211|PhyH| RP:SCP:NREP 1 RP:SCP:REP 18->228|2a1xA1|1e-27|25.0|196/253|b.82.2.9| HM:SCP:REP 6->287|2a1xA1|3.3e-49|31.3|265/0|b.82.2.9|1/1|Clavaminate synthase-like| OP:NHOMO 147 OP:NHOMOORG 77 OP:PATTERN -------------------------------------------------------------------- --------------11111-1---1-1111111---2-13-----11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1--------------------------4----1---------------------------------------------------------------------2--2---------------------------2---1-1--11-----------------------------------------------------------------------------------------------------1----------1----------------------------------------------------------------------------------------------------------------------------------------------------------2-----2-------------------------------------------------------------------------------------------------------- ---------------32--4341442111-1--34332-1122---2124-47522-2------1--1-------2-211------------2---1-1---------5-----------------------------------------------------------------------------------------2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 269 STR:RPRED 93.7 SQ:SECSTR #########cccccccccHHHHHHHHHcEEEEETcccHHHHHHHHHHHHHHHHHTccccHHHHHHHTcHHHHHHHHHHHTTcccEETTEEccEEEEEccccccEEEccTTcccccHTHHHHTccGGGccTTccTTGGGGcccccccccccccEEEEEEcccccTTcccEEEcccTTHHHHHHHGGGcTcEEcccccTTcEEEEETTccEEEcccccccccccEEEccccEEcHHHHHHHHcccTTcGGGGGGccHHHHHHHHcEEEEcHH#HHHH#HHHH####### DISOP:02AL 1-2| PSIPRED cccccccccEEcccccHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHHcccccccHHccccccccccEEEHHHHHccHHHHHHHcccHHHHHHHHHHHcccccEEEEEEHHHEEcccccccccccccccccccccccccccccEEEEEEEEEEccccccccEEEEcccccccccccccccccEEEEEEccccEEEEcccEEccccccccccccEEEEEEEEccHHccccccEEEEccHHHHHcccHHHHHHHccccccccccccEEEEccccHHHHHccc //