[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56125.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:235 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   50->112 PF08449 * UAA 2.1e-06 21.0 62/303  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56125.1 GT:GENE BAD56125.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1433496..1434203 GB:FROM 1433496 GB:TO 1434203 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56125.1 LENGTH 235 SQ:AASEQ MSTTRMILVLLADLAMVGAGFYYGIRLLRGFRNFLLGLEWVVMAVSGVNVLFLAAINVDHESLSYHLMVFFDAFSRSFGMTVILVVGLLAVTHRYRPSWVVEALAIVAGIAVGLNRALEPRPVEPSWAIFYLVMNLAAALFVFVYLVPKLWRGGDRGNATWVALGAALGAYVAIIYDYFPIPGDDAEHTLFYIISLTIWALMIVTFSRGYLALERLNAQADARTSAPEAASPSAR GT:EXON 1|1-235:0| TM:NTM 7 TM:REGION 1->23| TM:REGION 37->59| TM:REGION 71->92| TM:REGION 97->118| TM:REGION 127->149| TM:REGION 161->183| TM:REGION 188->210| SEG 26->38|rllrgfrnfllgl| SEG 162->176|valgaalgayvaiiy| HM:PFM:NREP 1 HM:PFM:REP 50->112|PF08449|2.1e-06|21.0|62/303|UAA| OP:NHOMO 17 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------1-13----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----------------2----1---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1--1-------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 218-235| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //