[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56127.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.160.1
:404 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   241->372 1zatA PDBj 2e-08 26.6 %
:RPS:SCOP  243->372 1zatA1  b.160.1.1 * 1e-23 23.8 %
:HMM:SCOP  244->373 1zatA1 b.160.1.1 * 2.1e-29 26.4 %
:HMM:PFM   253->371 PF03734 * YkuD 2.9e-18 27.7 101/116  
:BLT:SWISS 55->396 Y493_MYCBO 1e-53 34.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56127.1 GT:GENE BAD56127.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1436355..1437569 GB:FROM 1436355 GB:TO 1437569 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56127.1 LENGTH 404 SQ:AASEQ MMSVGPRRRRVLRALSLPAVLLAVLALALTACTSSNGGGSAVAIDRNPITELIKPKLLSPVKDGDKGVSPAAPMTFQVEDGRFTDVTLVNQQGKAVQGKLAADGRTWETTEVLGYGKTYRLTAEAIGLGGVNSTTLSFTTSSPDNQTKPYLIPGEGEVVGIGQPVAIQFDENIPDRRAAQDVIKITTNPPVEGAFYWLNNREVRWRPEHFWAPGTRVDIEVNVYGKDLGNGLYGQENITSHFIVGDAVIFTADDNTKQVVVEQNGQVIRTMPTSMGKDSTPTDNGIYIVADKHEKIIMDSSTYGVAVNSPDGYRTPVDFATRISYSGIFFHSAPWSVGAQGNSNTSHGCLNLSPANAQWVYNFAKRGDITIIKNTVGGTLSGTDGLGDWNIPWSVWKAGNADIG GT:EXON 1|1-404:0| BL:SWS:NREP 1 BL:SWS:REP 55->396|Y493_MYCBO|1e-53|34.9|335/451| TM:NTM 1 TM:REGION 11->32| SEG 7->29|rrrrvlralslpavllavlalal| SEG 377->388|ggtlsgtdglgd| BL:PDB:NREP 1 BL:PDB:REP 241->372|1zatA|2e-08|26.6|124/248| HM:PFM:NREP 1 HM:PFM:REP 253->371|PF03734|2.9e-18|27.7|101/116|YkuD| RP:SCP:NREP 1 RP:SCP:REP 243->372|1zatA1|1e-23|23.8|122/126|b.160.1.1| HM:SCP:REP 244->373|1zatA1|2.1e-29|26.4|125/0|b.160.1.1|1/1|L,D-transpeptidase catalytic domain-like| OP:NHOMO 212 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- ----511111111156655-5E44565555549699448711111-------1121-1--32112239551-----------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 30.7 SQ:SECSTR ################################################################################################################################################################################################################################################cccccccEE#EEETTTTEEEEEETTEEEEEEEcccccTTcccccEEEEccccEEEEEc#ccccccccccEEEEEEEcc######ccccEEEEcTTcccccTTHHcccccEEEcHHHHHHHHHHccTTcEEEE################################ DISOP:02AL 1-10, 34-50, 403-404| PSIPRED cccccccccEEEEEEHHHHHHHHHHEEEEEEccccccccccccccccccccHHccEEEEEcccccccccccccEEEEEcccEEEEEEEEcccccEEEEEEcccccEEccccccccccEEEEEEEEcccccccccccEEEEEcccccccEEEEcccccEEEEEEEEEEEEccccccHHHHccEEEEEcccccEEEEEEEcccEEEEEEccccccccEEEEEEEcccccccccccccccEEEEEEEccEEEEEEEccccEEEEEEccEEEEEEEEEccccccccccEEEEEEEccccEEEccccccccccccccccccccEEEEEccccEEEEcccccccccccccccccEEEccHHHHHHHHHHcccccEEEEEcccccccccccccccccccHHHHcccccccc //