[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56129.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:93 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  4->81 3stdA_ d.17.4.1 * 7e-08 21.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56129.1 GT:GENE BAD56129.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1437967..1438248) GB:FROM 1437967 GB:TO 1438248 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56129.1 LENGTH 93 SQ:AASEQ MSRHEGRHRILDMHHGMMPDLTVHGPTRAGGRWTLRFTQLDLLAGTQTLSAIEYDDDYVVEDGEWRMRKSHARTLWSLTQPLSPDAVITDNLP GT:EXON 1|1-93:0| SEG 53->62|eydddyvved| HM:SCP:REP 4->81|3stdA_|7e-08|21.3|75/0|d.17.4.1|1/1|NTF2-like| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccccccccEEEEEEccccEEEEcccccEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEccEEEEEEEEEEEEEEEEEEEcccEEEEcccc //