[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56130.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:73 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   16->64 3b8lB PDBj 1e-04 18.8 %
:RPS:SCOP  15->69 3ebyA1  d.17.4.4 * 1e-05 10.9 %
:HMM:SCOP  12->73 3stdA_ d.17.4.1 * 2.3e-06 34.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56130.1 GT:GENE BAD56130.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1438245..1438466) GB:FROM 1438245 GB:TO 1438466 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56130.1 LENGTH 73 SQ:AASEQ MTDERTAGAGVSVQDLARLEAIKRLKYRYWRACDTKDPAGIRACFVRAGADIDFGPLGRFDADGLVRVFETSR GT:EXON 1|1-73:0| RP:PDB:NREP 1 RP:PDB:REP 16->64|3b8lB|1e-04|18.8|48/137| RP:SCP:NREP 1 RP:SCP:REP 15->69|3ebyA1|1e-05|10.9|55/153|d.17.4.4| HM:SCP:REP 12->73|3stdA_|2.3e-06|34.4|61/0|d.17.4.1|1/1|NTF2-like| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1-----------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 51 STR:RPRED 69.9 SQ:SECSTR #############ccHHHHHHHHHHHHHHHHHHTTccHHHHHTTEEEEEEEEEcGGGTcccEEH######### DISOP:02AL 1-7| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccEEcccccccccHHHHHHHHHccc //