[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56137.1
DDBJ      :             putative transporter
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  109/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:447 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   375->406 2zuyA PDBj 3e-04 40.6 %
:HMM:SCOP  1->445 1pv7A_ f.38.1.2 * 2e-43 24.1 %
:RPS:PFM   16->402 PF11700 * ATG22 1e-27 29.8 %
:HMM:PFM   16->432 PF11700 * ATG22 2.1e-46 22.7 405/477  
:BLT:SWISS 320->400 YXIO_BACSU 3e-07 31.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56137.1 GT:GENE BAD56137.1 GT:PRODUCT putative transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1446118..1447461 GB:FROM 1446118 GB:TO 1447461 GB:DIRECTION + GB:PRODUCT putative transporter GB:PROTEIN_ID BAD56137.1 LENGTH 447 SQ:AASEQ MTDARETIGQAAGRGQVVAWGLWDWGSSAFHAVILTFVFSVYLTDTVGDDLPGDVSASAWLGWALGLAGLVVALTAPISGQWFDAAAKRKRALGVLTAVVVAAMTAMFFVHDDHRDLWLGLALLAVGSAAFELANVPYNAMLRQVSTPATVGRVSGFGWAMGYFGGIFLLLICYFGFIAGDGDTRGLLGIPTDDGLNIRLIAVLAAVWFAAFALPVMFAVPELPRTTADPGAERAGLLGSYRVLWRDLRELWAVDRRTVWFLLASAVFRDGLAGVFTFGAVLAVRVYGIDDADVLLFGIAANVVAALGAIAAGRFDDRVGPKAVIVGSLAAMLVCGLALLVVSGPVLFWVFGLLLTIFVGPAQASARSFLARLAPPGREGQLFGLYTTTGRAVSFLAPALFGFFVWAFDAERAGIVGLLVVLGAGLLVLLPVRGPEPAAVEALEDTA GT:EXON 1|1-447:0| BL:SWS:NREP 1 BL:SWS:REP 320->400|YXIO_BACSU|3e-07|31.2|80/428| TM:NTM 12 TM:REGION 26->48| TM:REGION 59->81| TM:REGION 92->111| TM:REGION 116->138| TM:REGION 161->183| TM:REGION 198->220| TM:REGION 261->283| TM:REGION 293->315| TM:REGION 318->340| TM:REGION 344->366| TM:REGION 383->405| TM:REGION 418->440| SEG 56->74|sasawlgwalglaglvval| SEG 92->110|algvltavvvaamtamffv| SEG 117->130|lwlglallavgsaa| SEG 202->214|avlaavwfaafal| SEG 298->313|giaanvvaalgaiaag| SEG 412->435|ragivgllvvlgagllvllpvrgp| BL:PDB:NREP 1 BL:PDB:REP 375->406|2zuyA|3e-04|40.6|32/604| RP:PFM:NREP 1 RP:PFM:REP 16->402|PF11700|1e-27|29.8|373/416|ATG22| HM:PFM:NREP 1 HM:PFM:REP 16->432|PF11700|2.1e-46|22.7|405/477|ATG22| HM:SCP:REP 1->445|1pv7A_|2e-43|24.1|403/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 110 OP:NHOMOORG 109 OP:PATTERN -------------------------------------------------------------------- -------1111---11111-11111111111111111111-----11111--111112-----1---1-11---------1--------------------------------------------1-1--11--1-----1----------------------------------------------------------11-----1--------------1---------------------------------1---------------------------------------------------------------------------------------------------------------------1--------------1111111-----11--1-111---------111----111111111-1---111----111--------------11-----------------------------------111-1------------------------------------------1----1--------------1-------------------------1----------------------------------------1----------------------------1------------------------------------------------------------------------------------------------1111-1111-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 32 STR:RPRED 7.2 SQ:SECSTR ######################################################################################################################################################################################################################################################################################################################################################################################cTTccccEEEEEETTccEEEccccccccEEEc######################################### DISOP:02AL 1-17, 222-238, 444-447| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHccccc //