[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56139.1
DDBJ      :             putative oxidoreductase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  409/915 : Eukaryota  88/199 : Viruses  0/175   --->[See Alignment]
b.43.4c.25.1d.15.4
:352 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   63->246 1krhA PDBj 5e-15 33.3 %
:BLT:PDB   289->351 1fxiA PDBj 4e-05 38.1 %
:RPS:PDB   31->265 1cqxA PDBj 3e-34 23.7 %
:RPS:PDB   272->352 1a70A PDBj 9e-09 28.4 %
:RPS:SCOP  32->130 1ep1B1  b.43.4.2 * 6e-11 14.4 %
:RPS:SCOP  130->257 1tvcA2  c.25.1.2 * 4e-22 21.9 %
:RPS:SCOP  260->350 2piaA3  d.15.4.2 * 3e-11 23.1 %
:HMM:SCOP  30->133 1fdrA1 b.43.4.2 * 3e-20 35.4 %
:HMM:SCOP  120->255 1i7pA2 c.25.1.1 * 9.4e-31 40.4 %
:HMM:SCOP  247->352 1doiA_ d.15.4.1 * 7.6e-16 28.3 %
:RPS:PFM   47->132 PF00970 * FAD_binding_6 2e-05 38.1 %
:RPS:PFM   142->239 PF00175 * NAD_binding_1 5e-15 44.2 %
:HMM:PFM   142->240 PF00175 * NAD_binding_1 9.6e-15 33.7 98/109  
:HMM:PFM   48->130 PF00970 * FAD_binding_6 8e-15 30.9 81/99  
:HMM:PFM   281->342 PF00111 * Fer2 8.2e-07 27.6 58/77  
:BLT:SWISS 64->266 HMP_OCEIH 8e-19 35.0 %
:BLT:SWISS 289->351 FER1_PHYAM 5e-06 39.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56139.1 GT:GENE BAD56139.1 GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1448299..1449357 GB:FROM 1448299 GB:TO 1449357 GB:DIRECTION + GB:PRODUCT putative oxidoreductase GB:PROTEIN_ID BAD56139.1 LENGTH 352 SQ:AASEQ MVDLINLVQTLTTPHPVDRYLELIRPTLTLRQMRAEITEVDRSVLGSVTLTLRAPRQWRGHAAGQYVQIGVVIDGVRHTRCYSPIDPEGARDRRIRLTIKAHPEGLVSQYLHAHAAPGMVVDLSPAEGVFRLPDERPERILLIGGGSGITPVLSMLRTLVEEGHPGQITFLYYARSPEEVPHRAELHALARRHPALRLELRYPERGDKHFDYDELERVAPWFADGHTFLCGPPPLMAAVRTVFEAERLDDRLHSEEFVLTTAPVDPDQAHGTVHFSASGVRADNSGASLLDQAEAAGLSPEYGCRMGICFSCTAVRRSGCTRNLRTGETDSDPDQPIQLCVSAPVGDVDIDI GT:EXON 1|1-352:0| BL:SWS:NREP 2 BL:SWS:REP 64->266|HMP_OCEIH|8e-19|35.0|197/406| BL:SWS:REP 289->351|FER1_PHYAM|5e-06|39.7|63/96| BL:PDB:NREP 2 BL:PDB:REP 63->246|1krhA|5e-15|33.3|171/337| BL:PDB:REP 289->351|1fxiA|4e-05|38.1|63/96| RP:PDB:NREP 2 RP:PDB:REP 31->265|1cqxA|3e-34|23.7|232/403| RP:PDB:REP 272->352|1a70A|9e-09|28.4|81/97| RP:PFM:NREP 2 RP:PFM:REP 47->132|PF00970|2e-05|38.1|84/99|FAD_binding_6| RP:PFM:REP 142->239|PF00175|5e-15|44.2|95/107|NAD_binding_1| HM:PFM:NREP 3 HM:PFM:REP 142->240|PF00175|9.6e-15|33.7|98/109|NAD_binding_1| HM:PFM:REP 48->130|PF00970|8e-15|30.9|81/99|FAD_binding_6| HM:PFM:REP 281->342|PF00111|8.2e-07|27.6|58/77|Fer2| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00970|IPR008333| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00970|IPR008333| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00175|IPR001433| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00175|IPR001433| RP:SCP:NREP 3 RP:SCP:REP 32->130|1ep1B1|6e-11|14.4|97/101|b.43.4.2| RP:SCP:REP 130->257|1tvcA2|4e-22|21.9|128/141|c.25.1.2| RP:SCP:REP 260->350|2piaA3|3e-11|23.1|91/98|d.15.4.2| HM:SCP:REP 30->133|1fdrA1|3e-20|35.4|99/0|b.43.4.2|1/1|Riboflavin synthase domain-like| HM:SCP:REP 120->255|1i7pA2|9.4e-31|40.4|136/0|c.25.1.1|1/1|Ferredoxin reductase-like, C-terminal NADP-linked domain| HM:SCP:REP 247->352|1doiA_|7.6e-16|28.3|106/128|d.15.4.1|1/1|2Fe-2S ferredoxin-like| OP:NHOMO 1258 OP:NHOMOORG 498 OP:PATTERN --------------------------------------------1----------------------- -2113-12------64445-47--5B4444456898A6AB131511-3----33232---644-1446631----------------------------111111112---------------------------------------1-111-----------------1---------------1-------2111111111111111111111111-1111-1------111-----------------------------------------------------------------------------------------------------1-1-----------------------------------1-23--------1-5141--1----1111111-111-34324726-2--11111143224532---1162-12-221111111141111----------------------------------141-36324756958544458898444424D846D87--75343-3-444149132211221----------264--------------------------2-12---------------------------113322222-13122222-2222211121113----1-1------22131214221411143-344411142431233433455522-12222222222222222231223332--122222222222----------111231431111-1---------5665644-1-4-665636225574422221---------1223222221223311111111111111----22--------------1-------------------------------------- ----22------111122133215643111111----------1--12243454211222321-111111111-122222-1111-11-1--2111-----1---2--21---121---------------------------------------1-1-----1---1--2---------------12231---3123- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 342 STR:RPRED 97.2 SQ:SECSTR ##########EccccHHHHHHHHHTTccccccEEEEEEEEEEccccEEEEEEEETTccccccTTcEEEEEEEETTTTEEEEEEcccccccccEEEEEEccccTTcHHHHHHHHHccTTcEEEEccccccccccTTccccEEEEEccccHHHHHHHHHHHTccccTccEEEEEEEccccccHHHHHHHHHHHHcTTEEEEEEEccccTTcccTGGGcHHHHccTTcEEEEEccHHHHHHHHHHHHHTTccGGEEEcccEEcccTTcTTcEEHEEEETTEEEEEEETTccHHHHHHHTTcccccccccccccTTEEEEEEccEEcTTcccccHHHHTEEEGGGcEEcccEEEEc DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHcccccccHHHHccccccccEEEEEEEEEEEccccEEEEEEcccccccccccccEEEEEEEEcccEEEEEEEEcccccccccEEEEEEEEEcccHHHHHHHHHcccccEEEEEEccccccccccccccEEEEEccccHHHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHcccHHHHEEEEccccccccccccccEEEEEcccEEEEEcccccHHHHHHHccccccHHcccccccccEEEEEEccEEcccccccHHHHcccEEEEEEEEcccEEEEc //