[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56141.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->72 PF11098 * Chlorosome_CsmC 0.00068 30.4 56/139  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56141.1 GT:GENE BAD56141.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1450573..1450908 GB:FROM 1450573 GB:TO 1450908 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56141.1 LENGTH 111 SQ:AASEQ MMIGKFESNKDLIQELTSSGAKHIGNIATIITGTVAEVTREIGEWITDAIEMNEAAAAARRDAAAAGDADPSDAAPAAAERPVETEIVTPADPAASFVDAEVVDTDIDDRR GT:EXON 1|1-111:0| SEG 55->79|aaaaarrdaaaagdadpsdaapaaa| HM:PFM:NREP 1 HM:PFM:REP 15->72|PF11098|0.00068|30.4|56/139|Chlorosome_CsmC| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 63-73, 108-111| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEcccccHHHHHHHHHHcccccccc //