[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56142.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:132 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   45->74 PF09819 * ABC_cobalt 0.00088 26.7 30/129  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56142.1 GT:GENE BAD56142.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1450957..1451355) GB:FROM 1450957 GB:TO 1451355 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56142.1 LENGTH 132 SQ:AASEQ MLAAARALAGCHERRRRAQVATGTVAPTAAVAEIDRDRGLLVDRINAWVAANVVHRHGASLHTETLGAVIDRMAAKWVAAQAALRANDTRTQREPLTGGAAHLEWTRLAELADGYQDLVTEVGEHRRRLPVY GT:EXON 1|1-132:0| SEG 18->32|aqvatgtvaptaava| HM:PFM:NREP 1 HM:PFM:REP 45->74|PF09819|0.00088|26.7|30/129|ABC_cobalt| OP:NHOMO 3 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------3-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 131-132| PSIPRED cHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //