[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56145.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  244/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->161 2z90B PDBj 6e-30 52.5 %
:RPS:PDB   41->160 2chpC PDBj 3e-25 31.1 %
:RPS:SCOP  41->159 2fjcA1  a.25.1.1 * 3e-35 23.5 %
:HMM:SCOP  2->162 1dpsA_ a.25.1.1 * 1.5e-45 42.8 %
:RPS:PFM   44->159 PF00210 * Ferritin 3e-09 35.4 %
:HMM:PFM   26->160 PF00210 * Ferritin 1e-21 21.4 131/142  
:BLT:SWISS 41->159 FTPA_HAEDU 2e-20 37.8 %
:PROS 44->60|PS00818|DPS_1
:PROS 70->84|PS00819|DPS_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56145.1 GT:GENE BAD56145.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1453655..1454140 GB:FROM 1453655 GB:TO 1454140 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56145.1 LENGTH 161 SQ:AASEQ MTSTLTKSPITSTLGTAEQKAVGIVLQDALADLIDLSLLGKQAHWNVVGPHFRALHLQLDELVDAARGFVDAVAERAAALGVSPDGRLATVAATSGLPEFPTGYVADAEVVTAIVTTLDTAVRRMRERIDATDTADPVTQDLFIEITAELEKQRWMFQAQS GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 41->159|FTPA_HAEDU|2e-20|37.8|119/189| PROS 44->60|PS00818|DPS_1|PDOC00645| PROS 70->84|PS00819|DPS_2|PDOC00645| SEG 26->39|lqdaladlidlsll| BL:PDB:NREP 1 BL:PDB:REP 40->161|2z90B|6e-30|52.5|122/160| RP:PDB:NREP 1 RP:PDB:REP 41->160|2chpC|3e-25|31.1|119/145| RP:PFM:NREP 1 RP:PFM:REP 44->159|PF00210|3e-09|35.4|113/141|Ferritin| HM:PFM:NREP 1 HM:PFM:REP 26->160|PF00210|1e-21|21.4|131/142|Ferritin| GO:PFM:NREP 2 GO:PFM GO:0006879|"GO:cellular iron ion homeostasis"|PF00210|IPR008331| GO:PFM GO:0008199|"GO:ferric iron binding"|PF00210|IPR008331| RP:SCP:NREP 1 RP:SCP:REP 41->159|2fjcA1|3e-35|23.5|119/151|a.25.1.1| HM:SCP:REP 2->162|1dpsA_|1.5e-45|42.8|159/0|a.25.1.1|1/1|Ferritin-like| OP:NHOMO 295 OP:NHOMOORG 244 OP:PATTERN -------------------------------------------------------------------- ------11111-1-221----2---2------222221221111212-12211221111111-11112211-111111----------------1--------11--1-1--------------------------111-1------111--11111------1--1333-------------112-----1112222222222222221111-1222-11----11111112-1111111111111111111-----------------------------1----1----1---111-1111111111111-1-111111-------------------------1-------------------------1-1----------1--1------1-------------11-12-23-----111---------1----------1-------------11-1----------------------------------1------111111111111111111111-111-11--111---------------1---1-------------1-----------------------111121--------------------------------2---1-1-1-----------------------------------1--------------------------------------------------------1---------------------------------------1111-11------------------------111111111-111-----------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 161 STR:RPRED 100.0 SQ:SECSTR cccTTcTTcccTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHG DISOP:02AL 1-7| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcc //