[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56146.1
DDBJ      :             putative MutT family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:132 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->62 1nqzA PDBj 2e-07 52.1 %
:RPS:PDB   5->106 2b06A PDBj 4e-13 14.1 %
:RPS:SCOP  4->125 2o5fA1  d.113.1.2 * 4e-15 23.5 %
:HMM:SCOP  11->134 1hx3A_ d.113.1.2 * 4.1e-20 30.6 %
:RPS:PFM   12->106 PF00293 * NUDIX 1e-08 35.1 %
:HMM:PFM   13->109 PF00293 * NUDIX 6.5e-18 29.9 97/135  
:BLT:SWISS 11->65 RPPH_AERS4 8e-07 40.0 %
:PROS 31->52|PS00893|NUDIX_BOX

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56146.1 GT:GENE BAD56146.1 GT:PRODUCT putative MutT family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1454207..1454605 GB:FROM 1454207 GB:TO 1454605 GB:DIRECTION + GB:PRODUCT putative MutT family protein GB:PROTEIN_ID BAD56146.1 LENGTH 132 SQ:AASEQ MIRTAAFAHVRDRRLLQARSTGKEVFYMAGGKIDAGETPEQAMHREVREELGVDVVSYTELGVFRAAAYGHEPGVQLHMTCFTGVLDGDPTPSGEIAELRYFTVGEYGAMRHVAPGSLLVFQRLYDLGIIDW GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 11->65|RPPH_AERS4|8e-07|40.0|55/175| PROS 31->52|PS00893|NUDIX_BOX|PDOC00695| BL:PDB:NREP 1 BL:PDB:REP 13->62|1nqzA|2e-07|52.1|48/171| RP:PDB:NREP 1 RP:PDB:REP 5->106|2b06A|4e-13|14.1|99/150| RP:PFM:NREP 1 RP:PFM:REP 12->106|PF00293|1e-08|35.1|94/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 13->109|PF00293|6.5e-18|29.9|97/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 4->125|2o5fA1|4e-15|23.5|119/155|d.113.1.2| HM:SCP:REP 11->134|1hx3A_|4.1e-20|30.6|124/0|d.113.1.2|1/1|Nudix| OP:NHOMO 45 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2111---------11----1----1----11--11--------------------------------1-2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1-----------------------------------11---------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------1-----------------------------------------------------------1------------------1--------------------------------------1------------------------------------111------11-11111-1--1-----1-1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEETTTTEEEEEEEcccEEEcccccccTTccHHHHHHHHHHHHHcEEEEccEEEEEEEEEEEEcTTccEEEEEEEEEcEEEEcccccTTcEEEEEEGGGGGGcGcccHHHHTTHHHHHHHTcccT DISOP:02AL 132-133| PSIPRED cEEEEEEEEEcccEEEEEEccccccEEcccccccccccHHHHHHHHHHHHHccEEEEEEEEEEEEEccccccccEEEEEEEEEEEEccccccccccEEEEEEcHHHHHHccccccccHHHHHHHHHcccccc //