[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56152.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:176 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->130 2fujA PDBj 9e-09 31.0 %
:RPS:PDB   39->173 3ck1A PDBj 4e-12 19.4 %
:RPS:SCOP  42->174 2oiwA1  d.38.1.1 * 2e-19 19.7 %
:HMM:SCOP  39->170 1bvqA_ d.38.1.1 * 1.3e-20 25.2 %
:RPS:PFM   14->107 PF01643 * Acyl-ACP_TE 8e-04 26.2 %
:HMM:PFM   56->132 PF03061 * 4HBT 4.6e-09 25.0 72/79  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56152.1 GT:GENE BAD56152.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1465514..1466044 GB:FROM 1465514 GB:TO 1466044 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56152.1 LENGTH 176 SQ:AASEQ MTRRHGVRCAGCGRPTEVPHVTSSSNGNGQVHRDTLVLPKRFHAKVDIRWSDMDVFQHVNHARMVTLLEEARIPWLFEDGRPTAGMREGCVLADLRVRYRGQLRHEDTPLDIAMWIEQLRAVDFTVGYEVRANGAAPDSPAAVVASTQIAAFDIKTQRLRRLTAPEREYLSEWMDK GT:EXON 1|1-176:0| SEG 135->146|aapdspaavvas| BL:PDB:NREP 1 BL:PDB:REP 46->130|2fujA|9e-09|31.0|84/118| RP:PDB:NREP 1 RP:PDB:REP 39->173|3ck1A|4e-12|19.4|129/138| RP:PFM:NREP 1 RP:PFM:REP 14->107|PF01643|8e-04|26.2|84/229|Acyl-ACP_TE| HM:PFM:NREP 1 HM:PFM:REP 56->132|PF03061|4.6e-09|25.0|72/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 42->174|2oiwA1|2e-19|19.7|127/131|d.38.1.1| HM:SCP:REP 39->170|1bvqA_|1.3e-20|25.2|131/0|d.38.1.1|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 43 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- ----1---------11-11-11--11111111111111221----1-1111------1--111-1111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 77.3 SQ:SECSTR ######################################cccEEEEEEccGGGccTTccccHHHHHHHHHHHHHHHHHTccccHHHHTTTccEEEEEEEEcccccTTcEEEEEEEEEEEEcccEEEEEEEEcTTcEEEEEcEEEEEEEEEEcEEETTEEEccccHHHHHHHTTcc## DISOP:02AL 1-5, 17-33| PSIPRED ccccccEEEEEcccccccccEEEcccccccccHHcEEcccEEEEEEEEEEEEEccccEEHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEEEEHHcccccEEEEEEEEEEEccEEEEEEEEEEEcccccccEEEEEEEEEEEEEEccccccccccHHHHHHHHHHHcc //