[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56154.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->98 PF05437 * AzlD 1.3e-14 34.8 92/99  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56154.1 GT:GENE BAD56154.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1466819..1467130) GB:FROM 1466819 GB:TO 1467130 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56154.1 LENGTH 103 SQ:AASEQ MTLVAGVVALAAGTYAFRWAGPALRSRVRFPERARRVLEIGAVVLLAALVAVTTLPFGTDKVGVALPAGVAVAGVLAWRRAPLLVVILAAAATTALLRALGLH GT:EXON 1|1-103:0| TM:NTM 4 TM:REGION 2->24| TM:REGION 37->58| TM:REGION 61->78| TM:REGION 81->100| SEG 3->13|lvagvvalaag| SEG 42->55|avvllaalvavttl| SEG 62->77|vgvalpagvavagvla| SEG 80->102|rapllvvilaaaattallralgl| HM:PFM:NREP 1 HM:PFM:REP 7->98|PF05437|1.3e-14|34.8|92/99|AzlD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 82-96| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccc //