[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56155.1
DDBJ      :             putative branched-chain amino acid permease
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:238 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   26->154 PF03591 * AzlC 5e-10 31.0 %
:HMM:PFM   18->155 PF03591 * AzlC 1.7e-35 39.1 138/143  
:BLT:SWISS 26->154 AZLC_BACSU 3e-08 27.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56155.1 GT:GENE BAD56155.1 GT:PRODUCT putative branched-chain amino acid permease GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1467127..1467843) GB:FROM 1467127 GB:TO 1467843 GB:DIRECTION - GB:PRODUCT putative branched-chain amino acid permease GB:PROTEIN_ID BAD56155.1 LENGTH 238 SQ:AASEQ MRSIWRTLDRETGLGIAAVCLAVGVIGISYGTTAVAAGFPAWLPIVLGTVVLAGGAEFLFLGILAAGGSPVAAVLAGLLVNARHLAYGLSVPDAVGTGWRRLIGVHVMNDEAVAMALAESDTRRRRAVYWACGLGVLLVWPVGAALGVLIGTLVPDTGALGLDAVFPAVLLALVIPALRDRTTFGAVAVGTAIALLSAPFLPAGLPVLLALSGVIYAALRLKSAEPAPARAESVAEAS GT:EXON 1|1-238:0| BL:SWS:NREP 1 BL:SWS:REP 26->154|AZLC_BACSU|3e-08|27.9|129/254| TM:NTM 6 TM:REGION 11->33| TM:REGION 36->58| TM:REGION 61->83| TM:REGION 130->152| TM:REGION 158->179| TM:REGION 192->214| SEG 64->82|laaggspvaavlagllvna| SEG 164->178|avfpavllalvipal| RP:PFM:NREP 1 RP:PFM:REP 26->154|PF03591|5e-10|31.0|129/142|AzlC| HM:PFM:NREP 1 HM:PFM:REP 18->155|PF03591|1.7e-35|39.1|138/143|AzlC| OP:NHOMO 52 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1111-1----111---1-1--1----1--11-----------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----1--------------------------------------------11---------------1-------------------------------------------------------------------------11---1-------------------------------111----11111111111111111-------------------------------------------------------11111-1-------------------------------------------1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 222-238| PSIPRED cccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //